For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    biotin-hiv1-gp120-antibody-ab53937.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Microbiology Organism Virus RNA Virus ssRNA positive strand virus HIV
Share by email

Biotin Anti-HIV1 gp120 antibody (ab53937)

  • Datasheet
  • SDS
Submit a review Q&A (9)References (9)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Key features and details

  • Biotin Goat polyclonal to HIV1 gp120
  • Suitable for: WB, ELISA, IHC-Fr, ICC/IF
  • Reacts with: Species independent
  • Conjugation: Biotin
  • Isotype: IgG

You may also be interested in

Conjugation
Product image
Streptavidin Alexa Fluor® 488 Monovalent Antibody Labeling Kit (ab272187)
Protein
Recombinant HIV1 gp120 protein (ab73769)

View more associated products

Overview

  • Product name

    Biotin Anti-HIV1 gp120 antibody
    See all HIV1 gp120 primary antibodies
  • Description

    Biotin Goat polyclonal to HIV1 gp120
  • Host species

    Goat
  • Conjugation

    Biotin
  • Tested applications

    Suitable for: WB, ELISA, IHC-Fr, ICC/IFmore details
  • Species reactivity

    Reacts with: Species independent
  • Immunogen

    Full length native protein (purified) corresponding to HIV1 gp120. Purified native gp120 from strain IIIB.

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.1% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purification notes

    Purified IgG conjugated to Biotin.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Microbiology
    • Organism
    • Virus
    • RNA Virus
    • ssRNA positive strand virus
    • HIV
    • Immunology
    • Immune System Diseases
    • Antiviral Signaling
    • HIV

Associated products

  • Isotype control

    • Biotin Goat IgG - Isotype Control (ab37376)
  • Recombinant Protein

    • Recombinant HIV1 gp120 protein (ab73769)

Applications

Our Abpromise guarantee covers the use of ab53937 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent dilution.
ELISA Use at an assay dependent dilution.
IHC-Fr Use at an assay dependent dilution.
ICC/IF Use at an assay dependent dilution.

Target

  • Relevance

    HIV1 is equipped with the envelope gp160 glycoprotein for interaction with Langerhans cells (LCs) and dendritic cells (DCs), the members of the innate immune system, which confront the virus at the portal of virus entry in the human body. These cells are equipped with receptors by which they bind and endocytose the virus. The gp120 glycoprotein is used for binding to CD4 receptor and CCR5 co-receptor of T helper 2 (Th2) cells, and is able to induce FcepsilonRI(+) hematopoietic cells to produce IL4, which inactivates the host adaptive immune response.
  • Cellular localization

    Envelope surface glycoprotein.
  • Alternative names

    • Glycoprotein 120 antibody
    • gp120 antibody
    • SU antibody
    • Surface protein antibody

Protocols

  • Immunohistochemistry protocols
  • Immunocytochemistry & immunofluorescence protocols
  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

    • Datasheet
    • SDS
  • References (9)

    Publishing research using ab53937? Please let us know so that we can cite the reference in this datasheet.

    ab53937 has been referenced in 9 publications.

    • Beraud C  et al. Reassessment of the capacity of the HIV-1 Env cytoplasmic domain to trigger NF-?B activation. Virol J 15:35 (2018). PubMed: 29454367
    • Safavieh M  et al. Paper microchip with a graphene-modified silver nano-composite electrode for electrical sensing of microbial pathogens. Nanoscale 9:1852-1861 (2017). PubMed: 27845796
    • Santos da Silva E  et al. The Envelope Cytoplasmic Tail of HIV-1 Subtype C Contributes to Poor Replication Capacity through Low Viral Infectivity and Cell-to-Cell Transmission. PLoS One 11:e0161596 (2016). WB . PubMed: 27598717
    • Shafiee H  et al. Printed Flexible Plastic Microchip for Viral Load Measurement through Quantitative Detection of Viruses in Plasma and Saliva. Sci Rep 5:9919 (2015). PubMed: 26046668
    • Inci F  et al. Multitarget, quantitative nanoplasmonic electrical field-enhanced resonating device (NE2RD) for diagnostics. Proc Natl Acad Sci U S A 112:E4354-63 (2015). PubMed: 26195743
    • Shafiee H  et al. Nanostructured optical photonic crystal biosensor for HIV viral load measurement. Sci Rep 4:4116 (2014). PubMed: 24576941
    • Reuven EM  et al. The HIV-1 envelope transmembrane domain binds TLR2 through a distinct dimerization motif and inhibits TLR2-mediated responses. PLoS Pathog 10:e1004248 (2014). ICC/IF ; Mouse . PubMed: 25121610
    • Øynebråten I  et al. Increased generation of HIV-1 gp120-reactive CD8+ T cells by a DNA vaccine construct encoding the chemokine CCL3. PLoS One 9:e104814 (2014). PubMed: 25122197
    • Kim YG  et al. Quantum dot-based HIV capture and imaging in a microfluidic channel. Biosens Bioelectron 25:253-8 (2009). PubMed: 19665685

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-9 of 9 Abreviews or Q&A

    Question

    ich hoffe, dies ist die richtige email-Adresse für meine Anfrage. Ich würde gerne möglichst genau die (wahrscheinlich durchschnittliche) Molare Masse des Biotin-verlinkten Antikörpers Anti-HIV1 gp120 antibody (Biotin) (ab53937) erfahren, da ich sie für eine Rechnung brauche. Können Sie mir hierbei helfen?

    Read More

    Abcam community

    Verified customer

    Asked on Sep 20 2012

    Answer

    Vielen Dank für Ihre Anfrage.

    Leider muss ich Ihnen mitteilen, dass dies nicht zu unseren Standartmethoden gehört, wenn wir einen Antikörper entwickeln und charakterisieren.

    Was Sie allerdings machen könnten, wenn Sie diesen Antikörper bereits erworben haben um das ungefähre Gewicht zu ermitteln, wäre einen WB unter Nicht-reduzierenden Bedingungen, also ohne beta-Mercapthoethanol oder DTT Zugabe, mit dem Antikörper als Probe laufen zu lassen: Der Antikörper sollte sich (zum größten Teil) nicht in die leichte und schwere Kette aufspalten, und die Biotin-Konkugationsollte ebenfalls erhalten bleiben.

    Ich hoffe, dies hilft Ihnen trotzdem weiter. Bitte zögern Sie nicht, sich wieder bei uns zu melden, falls Sie weitere Fragen haben.

    Benutzen Sie unsere Produkte? Schicken Sie uns einen Abreview. Verdienen Sie sich eine Belohnung!
    https://www.abcam.com/abreviews

    Read More

    Abcam Scientific Support

    Answered on Sep 20 2012

    Question

    I have tested this antibody in ELISA. While I detected no signal in bovine sera, there was a strong positive signal in human sera. I would like a refund.

    Read More

    Abcam community

    Verified customer

    Asked on Jul 18 2012

    Answer

    Thank you for contacting us.

    I am sorry that this antibody did not perform as stated on the datasheet. If payment has already been made on the original order and you wish to receive a refund, please ask your purchasing department to contact our accounting department so that we may gather the correct information needed for the refund. To avoid confusion, please ensure your accounts department is aware of how the credit note is being used.

    Our accounting department can be contacted by email at us.credits@abcam.com or by telephone using the information at the Contact Us link in the top right corner of our website. Please refer to the credit note ID in any correspondence with our accounting department.


    I hope this experience will not prevent you from purchasing other products from us in the future. Our Scientific Support team is always at your service, should you require further expert advice.

    Read More

    Abcam Scientific Support

    Answered on Jul 18 2012

    Question

    Dear Madame or Sir,
    I
    have a question concerning the Anti-HIV1 gp120 antibody (Biotin)
    (ab53937). Does this antibody react also with other HIV strains (HXB2 or
    JRFL)?
    Thank you very much
    Best regards

    Read More

    Abcam community

    Verified customer

    Asked on Jul 04 2012

    Answer

    Thank you for your enquiry and your interest in our products.
    This antibody has not been tested against the HXB2 or JRFL strains yet. However, given the polyclonal nature of the antibody, there is a good chance it would react to these strains but currently we do not have any empirical data to support this.
    If you need any further assistance in the future, please do not hesitate to contact me.

    Read More

    Abcam Scientific Support

    Answered on Jul 04 2012

    Question

    Quiero pedir los anticuerpos ab9071 y ab83937. Cual es su precio y disponibilidad?
    Como se realiza el pedido?
    Muchas gracias.

    Read More

    Abcam community

    Verified customer

    Asked on Jun 11 2012

    Answer

    Gracias por contactarnos.

    Anti-HIV1 p24 [39/5.4A] (ab9071) tiene un precio de 370€ y se encuentra actualmente en stock, por lo que si lo pedís esta tarde o mañana (martes 12) a lo largo del día (antes de las 17 horas) lo recibiréis al día siguiente o en dos días como máximo.

    Anti-HIV1 gp120 antibody (Biotin) (ab53937) tiene el mismo precio (370€), pero no está en stock en nuestro almacén de Inglaterra, por lo que tardaría alrededor de una semana en llegaros.

    Si necesitáis un presupuesto, información sobre descuentos y promociones o mas información acerca de nuestros productos podéis contactarnos por teléfono (91 114 65 54) o por correo electrónico (mailto:orders@abcam.com).

    Para realizar un pedido, escribir a la dirección indicada un mail con los productos requeridos, direcciones de envío y facturación, teléfono de contacto, y CIF de la Universidad.

    Si necesitas más información, estaremos encantados de poder ayudarte.

    Read More

    Abcam Scientific Support

    Answered on Jun 11 2012

    Question

    Customer kindly called to inquire about the exact immunogen sequence for ab53937.

    Read More

    Abcam community

    Verified customer

    Asked on May 22 2012

    Answer

    Thank you for contacting us. This product is raised from purified native gp120 from strain IIIB. We have not sequenced the native protein used to raise this antibody. We have searched, and unfortunately, the gp120 sequence has not been submitted for strain IIIB. Linked below is the entire genome for strain IIIB. gp120 is encoded by the env gene, but without knowing for sure which promoter and reading frame is used for this strain we cannot send specifically the gp120 sequence. http://www.hiv.lanl.gov/components/sequence/HIV/asearch/query_one.comp?se_id=18154 I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information. Use our products? Submit an Abreview. Earn rewards! https://www.abcam.com/abreviews

    Read More

    Abcam Scientific Support

    Answered on May 22 2012

    Question

    What is the protein sequence of HIV1 pg120?

    Read More

    Abcam community

    Verified customer

    Asked on May 17 2012

    Answer

    Thank you for contacting us.

    Here is the sequence you requested:

    gp120 [Human immunodeficiency virus 1]
    GenBank: AAF69493.1
    GenPept Graphics





    >gi|7769646|gb|AAF69493.1|AF236860_1 gp120 [Human immunodeficiency virus 1]
    VPVWKDAETTLFCASDAKAHETEVHNVWATHACVPTDPNPQEIQLKNVTENFNMWKNNMVEQMQEDVISL
    WDQSLKPCVKLTPLCVTLNCTDATLTNSTYITNVSKIIGDITEEVRNCSFNMTTELRDKKQKVHALFL


    I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.


    Use our products? Submit an Abreview. Earn rewards!
    https://www.abcam.com/abreviews

    Read More

    Abcam Scientific Support

    Answered on May 17 2012

    Question

    Hi, I have two negative controls, gp120- and gp120+, both were only blotted with secondary antibody streptavidin. Gp120- is wild type and Gp120+ is HIV-1 transgenic rats. The positive samples are all gp120+ transgenic rats sample which blotted with primary gp120 and secondary streptavidin. You are right about the non-specifically binding. How could I reduce this non-specifically binding? The protocol as you asked: All the samples are cerebellum tissue from rat brain. Tissue were prepared in membrane protein lysis buffer added proteinase inhibitor and phosphatase inhibitor. 20ug proteins were loaded to gel and transferred to membrane overnight at room temperature. Membrane was blocked by LI-Cor blocking buffer for 1hr at RT and rinsed with PBS then membrane was cut into 2 piece: one piece was incubated with anti-gp120 while the other was incubated with PBS, both were incubated at RT for over 1 hour. Loading control beta-actin was added at last 30 min. Then membrane were washed with 1xPBST for 4 times, 5 min each. Membrane then incubated in secondary antibody streptavidin (1:10000) for 1 hour at rt. After 20 min, secondary anti-mouse (for beta-actin) was added to solution. wash membrane with 1xPBST for 4 times, 5 min each. Rinse with PBS and scan. All the incubation and wash were on shaker. Please let me know if you need more information. Thank you!

    Read More

    Abcam community

    Verified customer

    Asked on Jan 05 2012

    Answer

    Thank you for your reply. To reduce the non-specific binding of your secondary antibody, you could: - Change your blocking agent, to either 5% non fat dried milk or 5% BSA. - Lower the concentration of the secondary antibody that you are using. - Add between 0.1-0.55 Tween20 to the secondary antibody solution. - Increase the number of wash steps that you are currently using. Hopefully some of the protocol tips would help alleviate the problem. If you continue to see non-specific binding of the secondary antibody, then if you purchased it from Abcam, I would be happy to send a replacement. If you purchased it from another company, then I would suggest contacting them and asking them for a replacement antibody. Please let me know if there is anything else I can help you with.

    Read More

    Abcam Scientific Support

    Answered on Jan 05 2012

    Question

    Hello, The Gp120 (ab53937) I ordered gave a great results on IHC. However, when I try to use it for western blotting, all my negative and positive control samples gave similar binds around 120 KD. Below is the condition I used. I also attached a pic of my wb. For positive control: primary antibody: gp120, 1:1000; secondary antibody: streptavidin, 1:10000; blocking buffer: Li-cor blocking buffer. For negative control: primary antibody: none

    Read More

    Abcam community

    Verified customer

    Asked on Jan 04 2012

    Answer

    Thank you for contacting Abcam. I just want to make sure that I understand your negative control correctly; for your negative control, you added the secondary antibody only (no primary antibody) and that is the lane labeled 'gp120 negative'. Is that correct? If so, then I believe that the issue is that your secondary antibody is non-specifically binding to the other bands, as you are seeing the same banding pattern, in the secondary only lane (no ab53937 present). If I am reading your image incorrectly, I do apologize. Would you be able to send me more information on the protocol you used, including the samples that were loaded onto the gel. By sending this extra information, I will hopefully be able to help you more. I look forward to your reply.

    Read More

    Abcam Scientific Support

    Answered on Jan 04 2012

    Question

    Can you tell me if these products are from the same origin (ab21179, ab20105, ab20262, ab20008, ab53840, ab53937).I am looking for the non-conjugated form of ab53937 and ab20105.

    Read More

    Abcam community

    Verified customer

    Asked on Apr 08 2008

    Answer

    Thank you for your enquiry. These 4 products (ab21179, ab20105, ab20262, ab20008) were produced from the same goat antiserum. Catalog ab21179 is the purified antibody. The purified antibody is then labeled to produce the other catalog numbers: Biotin (ab20105), FITC (ab20262), HRP (ab20008). Meanwhile, ab53840 and ab53937 originate from the same goat antisera. Unfortunately, we do not have the unconjugated version of these antibodies in our catalog but I may check with the originator if it is available. Please let me know if you would like to proceed with an order.

    Read More

    Abcam Scientific Support

    Answered on Apr 08 2008

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.