Biotin Anti-Interferon gamma antibody [4S.B3] (ab190306)

Submit a review Submit a question

Key features and details

  • Biotin Mouse monoclonal [4S.B3] to Interferon gamma
  • Reacts with: Human, Non human primates
  • Conjugation: Biotin
  • Isotype: IgG1

Overview

  • Product name

    Biotin Anti-Interferon gamma antibody [4S.B3]
    See all Interferon gamma primary antibodies

  • Description

    Biotin Mouse monoclonal [4S.B3] to Interferon gamma

  • Host species

    Mouse

  • Conjugation

    Biotin

  • Specificity

    ab190306 binds both glycosylated and non-glycosylated protein.

  • Species reactivity

    Reacts with: Human, Non human primates

  • Immunogen

    Full length native protein (purified) corresponding to Human Interferon gamma aa 24-161. (Derived from Human leukocytes).
    Sequence:

    QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIV SFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSV TDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG


    Database link: P01579
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Target

  • Function

    Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.

  • Tissue specificity

    Released primarily from activated T lymphocytes.

  • Involvement in disease

    In Caucasians, genetic variation in IFNG is associated with the risk of aplastic anemia (AA) [MIM:609135]. AA is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis.

  • Sequence similarities

    Belongs to the type II (or gamma) interferon family.

  • Post-translational
    modifications

    Proteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161.

  • Cellular localization

    Secreted.
  • Information by UniProt

  • Database links

    • Alternative names

      • IF 1 antibody
      • IFG antibody
      • IFI antibody
      • IFN gamma antibody
      • IFN immune antibody
      • IFN, immune antibody
      • IFN-gamma antibody
      • IFNG antibody
      • IFNG_HUMAN antibody
      • Immune interferon antibody
      • Interferon gamma antibody
      • Type II Interferon antibody
      see all

    References (0)

    Publishing research using ab190306? Please let us know so that we can cite the reference in this datasheet.

    ab190306 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab190306.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com