Biotin Anti-Interferon gamma antibody [4S.B3] (ab190306)
Key features and details
- Biotin Mouse monoclonal [4S.B3] to Interferon gamma
- Reacts with: Human, Non human primates
- Conjugation: Biotin
- Isotype: IgG1
Overview
-
Product name
Biotin Anti-Interferon gamma antibody [4S.B3]
See all Interferon gamma primary antibodies -
Description
Biotin Mouse monoclonal [4S.B3] to Interferon gamma -
Host species
Mouse -
Conjugation
Biotin -
Specificity
ab190306 binds both glycosylated and non-glycosylated protein. -
Species reactivity
Reacts with: Human, Non human primates -
Immunogen
Full length native protein (purified) corresponding to Human Interferon gamma aa 24-161. (Derived from Human leukocytes).
Sequence:QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIV SFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSV TDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
Database link: P01579 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark. -
Storage buffer
pH: 7.40
Preservative: 0.0975% Sodium azide
Constituents: 99% PBS, 0.2% BSA -
Concentration information loading...
-
Purity
Size exclusion -
Purification notes
Purified antibody is conjugated with Biotin-LC-NHS under optimum conditions. The reagent is free of unconjugated biotin. -
Clonality
Monoclonal -
Clone number
4S.B3 -
Isotype
IgG1 -
Research areas
Associated products
-
Alternative Versions
-
Isotype control
-
Recombinant Protein
Target
-
Function
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. -
Tissue specificity
Released primarily from activated T lymphocytes. -
Involvement in disease
In Caucasians, genetic variation in IFNG is associated with the risk of aplastic anemia (AA) [MIM:609135]. AA is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis. -
Sequence similarities
Belongs to the type II (or gamma) interferon family. -
Post-translational
modificationsProteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 3458 Human
- Omim: 147570 Human
- SwissProt: P01579 Human
- Unigene: 856 Human
-
Alternative names
- IF 1 antibody
- IFG antibody
- IFI antibody
see all
Datasheets and documents
References (0)
ab190306 has not yet been referenced specifically in any publications.