Biotin Anti-Interferon gamma antibody (ab193426)
Key features and details
- Biotin Rabbit polyclonal to Interferon gamma
- Suitable for: WB
- Reacts with: Guinea pig
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-Interferon gamma antibody
See all Interferon gamma primary antibodies -
Description
Biotin Rabbit polyclonal to Interferon gamma -
Host species
Rabbit -
Conjugation
Biotin -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Guinea pig -
Immunogen
Recombinant fragment corresponding to Guinea pig Interferon gamma aa 24-166.
Sequence:QSRFTNEIRILKNYFNADNSDVGDNGTLFVGILKNCQEESERKIFQSQIV SFYFKLFEKHFTDNQTVQNSMNTIKEQIITKFFKDNSSNKVQAFKNLIQI SVNDEHVQRQAIIELKKVIDDLSPNQRKRRRTQMLFQSRRASK
Database link: 100379568 -
Positive control
- Recombinant Guinea Pig Interferon gamma protein
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), 49% PBS, 0.03% Proclin 300 -
Concentration information loading... -
Purity
Caprylic Acid - Ammonium Sulfate precipitation -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab193426 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 2 µg/ml. Predicted molecular weight: 20 kDa. |
Target
-
Function
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. -
Tissue specificity
Released primarily from activated T lymphocytes. -
Involvement in disease
In Caucasians, genetic variation in IFNG is associated with the risk of aplastic anemia (AA) [MIM:609135]. AA is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis. -
Sequence similarities
Belongs to the type II (or gamma) interferon family. -
Post-translational
modificationsProteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161. -
Cellular localization
Secreted. - Information by UniProt
-
Alternative names
- IF 1 antibody
- IFG antibody
- IFI antibody
see all
Images
-
Western blot - Biotin Anti-Interferon gamma antibody (ab193426)Biotin Anti-Interferon gamma antibody (ab193426) at 2 µg/ml + Recombinant Guinea Pig Interferon gamma protein at 10 µg
Secondary
Goat polyclonal to Rabbit IgG at 1/10000 dilution
Predicted band size: 20 kDa
References (0)
ab193426 has not yet been referenced specifically in any publications.
