Biotin Anti-LIF antibody (ab245854)
Key features and details
- Biotin Rabbit polyclonal to LIF
- Suitable for: Sandwich ELISA, WB
- Reacts with: Recombinant fragment
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-LIF antibody
See all LIF primary antibodies -
Description
Biotin Rabbit polyclonal to LIF -
Host species
Rabbit -
Conjugation
Biotin -
Tested applications
Suitable for: Sandwich ELISA, WBmore details -
Species reactivity
Reacts with: Recombinant fragment
Predicted to work with: Human -
Immunogen
Recombinant full length protein corresponding to Human LIF aa 23-202. Produced in E. coli. Full length mature chain without signal peptide.
Sequence:SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGE PFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRD QKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDT SGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Database link: P15018 -
Positive control
- WB: Recombinant human LIF protein. sELISA: Recombinant human LIF protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:Reconstitute in sterile PBS + 0.1% BSA to 0.1-1.0mg/ml. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark. -
Storage buffer
Constituent: PBS -
Concentration information loading...
-
Purity
Affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab245854 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
Sandwich ELISA | Use a concentration of 0.25 - 1 µg/ml. | |
WB | Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 22 kDa. No endogenous data, tested with recombinant protein only. |
Target
-
Function
LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes. -
Sequence similarities
Belongs to the LIF/OSM family. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 3976 Human
- Omim: 159540 Human
- SwissProt: P15018 Human
- Unigene: 2250 Human
-
Alternative names
- CDF antibody
- Cholinergic Differentiation Factor antibody
- D factor antibody
see all
Images
-
To detect human LIF by Western Blot analysis this antibody can be used at a concentration of 0.1 - 0.2 μg/ml.
When used in conjunction with compatible development reagents the detection limit for recombinant human LIF is 1.5 – 3.0 ng/lane, under either reducing or non-reducing conditions.
Lanes 1-12: 250, 125, 62.5, 31.25, 15.625, 7.8, 3.9, 1.95, 0.975, 0.4875 and 0.24 ng/lane respectively.
-
To detect human LIF by sandwich ELISA (using 100 μl/well) a concentration of 0.25 – 1.0 μg/ml of this antibody is required. This biotinylated polyclonal antibody, in conjunction with a capture antibody,allows the detection of at least 0.2 – 0.4 ng/well of recombinant human LIF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab245854 has not yet been referenced specifically in any publications.