Biotin Anti-Mannan Binding Lectin/MBL antibody [3B6] (ab191898)
![Sandwich ELISA - Biotin Anti-Mannan Binding Lectin/MBL antibody [3B6] (ab191898)](https://www.abcam.com/ps/products/191/ab191898/Images/ab191898-228834-ab191898ELISA1.jpg "Sandwich ELISA - Biotin Anti-Mannan Binding Lectin/MBL antibody [3B6] (ab191898)")
Key features and details
- Biotin Mouse monoclonal [3B6] to Mannan Binding Lectin/MBL
- Suitable for: Sandwich ELISA
- Reacts with: Human
- Conjugation: Biotin
- Isotype: IgG1
Overview
-
Product name
Biotin Anti-Mannan Binding Lectin/MBL antibody [3B6]
See all Mannan Binding Lectin/MBL primary antibodies -
Description
Biotin Mouse monoclonal [3B6] to Mannan Binding Lectin/MBL -
Host species
Mouse -
Conjugation
Biotin -
Specificity
ab191898 is specific for Mannan Binding Lectin/MBL from Human serum or plasma.
-
Tested applications
Suitable for: Sandwich ELISAmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee, Cynomolgus monkey, Gorilla, Common marmoset, Orangutan
-
Immunogen
Full length native protein (purified) corresponding to Human Mannan Binding Lectin/MBL aa 21-248. Mannan Binding Lectin purified from Human donor plasma.
Sequence:ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQ GPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA RIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAE NGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDE DCVLLLKNGQWNDVPCSTSHLAVCEFPI
Database link: P11226 -
Epitope
The epitope is on the head-neck region of the MBL protein chain. -
General notes
This product was previously labelled as Mannan Binding Lectin
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark. -
Storage buffer
pH: 7.40
Preservative: 0.09% Sodium azide
Constituents: 99% PBS, 0.81% Sodium chloride -
Concentration information loading... -
Purity
Affinity purified -
Purification notes
Biotinylated. -
Clonality
Monoclonal -
Clone number
3B6 -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Associated products
-
Alternative Versions
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab191898 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| Sandwich ELISA | Use at an assay dependent concentration. ab23457 may be used as the capture and ab191898 as the detection antibody. |
Target
-
Function
Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA. -
Tissue specificity
Plasma protein produced mainly in the liver. -
Involvement in disease
Note=There is an association between low levels of MBL2 and a defect of opsonization which results in susceptibility to frequent and chronic infections. -
Sequence similarities
Contains 1 C-type lectin domain.
Contains 1 collagen-like domain. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 449582 Chimpanzee
- Entrez Gene: 102120567 Cynomolgus monkey
- Entrez Gene: 101148598 Gorilla
- Entrez Gene: 4153 Human
- Omim: 154545 Human
- SwissProt: Q66S63 Chimpanzee
- SwissProt: Q66S61 Common marmoset
- SwissProt: Q66S50 Cynomolgus monkey
see all -
Alternative names
- COLEC 1 antibody
- COLEC1 antibody
- Collectin-1 antibody
see all
Images
-
Sandwich ELISA - Biotin Anti-Mannan Binding Lectin/MBL antibody [3B6] (ab191898)
Calibration curve for Mannan Binding Lectin/MBL using ab23457 as the capture antibody and ab191898 as the detection antibody.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab191898 has not yet been referenced specifically in any publications.
