For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    biotin-marv-gp-antibody-ab190459.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Microbiology Interspecies Interaction Host Virus Interaction
Share by email

Biotin Anti-MARV GP antibody (ab190459)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Biotin Anti-MARV GP antibody (ab190459)

    Key features and details

    • Biotin Rabbit polyclonal to MARV GP
    • Suitable for: WB
    • Conjugation: Biotin
    • Isotype: IgG

    You may also be interested in

    Protein
    Product image
    Streptavidin (HRP) (ab7403)

    View more associated products

    Overview

    • Product name

      Biotin Anti-MARV GP antibody
    • Description

      Biotin Rabbit polyclonal to MARV GP
    • Host species

      Rabbit
    • Conjugation

      Biotin
    • Tested applications

      Suitable for: WBmore details
    • Species reactivity

      Reacts with: Other species
    • Immunogen

      Synthetic peptide within MARV GP aa 436-681. The exact sequence is proprietary. Sequence is specific to the GP2 subunit.
      Sequence:

      SILWREGDMFPFLDGLINAPIDFDPVPNTKTIFDESSSSGASAEEDQHAS PNISLTLSYFPNINENTAYSGENENDCDAELRIWSVQEDDLAAGLSWIPF FGPGIEGLYTAVLIKNQNNLVCRLRRLANQTAKSLELLLRVTTEERTFSL INRHAIDFLLTRWGGTCKVLGPDCCIGIEDLSKNISEQIDQIKKDEQKEG TGWGLGGKWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG


      Database link: P35253
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
    • Storage buffer

      Constituent: 100% PBS
    • Concentration information loading...
    • Purity

      Immunogen affinity purified
    • Purification notes

      The purified antibody was conjugated with biotin at a molar ratio of 20:1 (Biotin: antibody), and purified from unconjugated biotin by diafiltration.
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Microbiology
      • Interspecies Interaction
      • Host Virus Interaction
      • Microbiology
      • Organism
      • Virus
      • RNA Virus
      • single stranded RNA negative strand virus
      • Marburg
      • Microbiology
      • Protein
      • Viral Protein

    Associated products

    • Isotype control

      • Biotin Rabbit IgG - Isotype Control (ab200208)

    Applications

    Our Abpromise guarantee covers the use of ab190459 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB Use at an assay dependent concentration. Predicted molecular weight: 74 kDa.

    Target

    • Relevance

      GP1 is responsible for binding to the receptor(s) on target cells. Interacts with CD209/DC-SIGN and CLEC4M/DC-SIGNR which act as cofactors for virus entry into the host cell. Binding to CD209 and CLEC4M, which are respectively found on dendritic cells (DCs), and on endothelial cells of liver sinusoids and lymph node sinuses, facilitate infection of macrophages and endothelial cells. These interactions not only facilitate virus cell entry, but also allow capture of viral particles by DCs and subsequent transmission to susceptible cells without DCs infection (trans infection). GP2 acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in GP2, releasing the fusion hydrophobic peptide.
    • Cellular localization

      GP2: Virion membrane; Single-pass type I membrane protein. Virion membrane; Lipid-anchor. Host cell membrane; Single-pass type I membrane protein. Host cell membrane; Lipid-anchor. Note: In the cell, localizes to the plasma membrane lipid rafts, which probably represent the assembly and budding site. GP1: Virion membrane; Peripheral membrane protein By similarity. Host cell membrane; Peripheral membrane protein. Note: GP1 is not anchored to the viral envelope, but associates with the extravirion surface through its binding to GP2. In the cell, both GP1 and GP2 localize to the plasma membrane lipid rafts, which probably represent the assembly and budding site.
    • Database links

      • Entrez Gene: 920945 Other species
      • SwissProt: P35253 Other species
      • Alternative names

        • Envelope glycoprotein antibody
        • GP1 antibody
        • GP1,2 antibody
        • GP2 antibody
        • Marburg virus antibody
        • Virion spike glycoprotein antibody
        see all

      Images

      • Western blot - Biotin Anti-MARV GP antibody (ab190459)
        Western blot - Biotin Anti-MARV GP antibody (ab190459)
        Lane 1 : Biotin Anti-MARV GP antibody (ab190459) at 0.0001 µg
        Lane 2 : Biotin Anti-MARV GP antibody (ab190459) at 0.0005 µg
        Lane 3 : Biotin Anti-MARV GP antibody (ab190459) at 0.001 µg
        Lane 4 : Biotin Anti-MARV GP antibody (ab190459) at 0.005 µg

        All lanes : Streptavidin-HRP

        Lysates/proteins at 1/6000 dilution per lane.

        Predicted band size: 74 kDa



        TMB substrate was used for visualization.

      Protocols

      • Western blot protocols

      Click here to view the general protocols

      Datasheets and documents

      • Datasheet
    • References (0)

      Publishing research using ab190459? Please let us know so that we can cite the reference in this datasheet.

      ab190459 has not yet been referenced specifically in any publications.

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      There are currently no Customer reviews or Questions for ab190459.
      Please use the links above to contact us or submit feedback about this product.

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.