Biotin Anti-MARV GP antibody (ab190459)
Key features and details
- Biotin Rabbit polyclonal to MARV GP
- Suitable for: WB
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-MARV GP antibody -
Description
Biotin Rabbit polyclonal to MARV GP -
Host species
Rabbit -
Conjugation
Biotin -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Other species -
Immunogen
Synthetic peptide within MARV GP aa 436-681. The exact sequence is proprietary. Sequence is specific to the GP2 subunit.
Sequence:SILWREGDMFPFLDGLINAPIDFDPVPNTKTIFDESSSSGASAEEDQHAS PNISLTLSYFPNINENTAYSGENENDCDAELRIWSVQEDDLAAGLSWIPF FGPGIEGLYTAVLIKNQNNLVCRLRRLANQTAKSLELLLRVTTEERTFSL INRHAIDFLLTRWGGTCKVLGPDCCIGIEDLSKNISEQIDQIKKDEQKEG TGWGLGGKWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG
Database link: P35253 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark. -
Storage buffer
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
The purified antibody was conjugated with biotin at a molar ratio of 20:1 (Biotin: antibody), and purified from unconjugated biotin by diafiltration. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab190459 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use at an assay dependent concentration. Predicted molecular weight: 74 kDa. |
Target
-
Relevance
GP1 is responsible for binding to the receptor(s) on target cells. Interacts with CD209/DC-SIGN and CLEC4M/DC-SIGNR which act as cofactors for virus entry into the host cell. Binding to CD209 and CLEC4M, which are respectively found on dendritic cells (DCs), and on endothelial cells of liver sinusoids and lymph node sinuses, facilitate infection of macrophages and endothelial cells. These interactions not only facilitate virus cell entry, but also allow capture of viral particles by DCs and subsequent transmission to susceptible cells without DCs infection (trans infection). GP2 acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in GP2, releasing the fusion hydrophobic peptide. -
Cellular localization
GP2: Virion membrane; Single-pass type I membrane protein. Virion membrane; Lipid-anchor. Host cell membrane; Single-pass type I membrane protein. Host cell membrane; Lipid-anchor. Note: In the cell, localizes to the plasma membrane lipid rafts, which probably represent the assembly and budding site. GP1: Virion membrane; Peripheral membrane protein By similarity. Host cell membrane; Peripheral membrane protein. Note: GP1 is not anchored to the viral envelope, but associates with the extravirion surface through its binding to GP2. In the cell, both GP1 and GP2 localize to the plasma membrane lipid rafts, which probably represent the assembly and budding site. -
Database links
- Entrez Gene: 920945 Other species
- SwissProt: P35253 Other species
-
Alternative names
- Envelope glycoprotein antibody
- GP1 antibody
- GP1,2 antibody
see all
Images
-
Lane 1 : Biotin Anti-MARV GP antibody (ab190459) at 0.0001 µg
Lane 2 : Biotin Anti-MARV GP antibody (ab190459) at 0.0005 µg
Lane 3 : Biotin Anti-MARV GP antibody (ab190459) at 0.001 µg
Lane 4 : Biotin Anti-MARV GP antibody (ab190459) at 0.005 µg
All lanes : Streptavidin-HRP
Lysates/proteins at 1/6000 dilution per lane.
Predicted band size: 74 kDaTMB substrate was used for visualization.
Datasheets and documents
References (0)
ab190459 has not yet been referenced specifically in any publications.