Biotin Anti-Mycobacterium tuberculosis 16kDa antibody (ab193390)
Key features and details
- Biotin Rabbit polyclonal to Mycobacterium tuberculosis 16kDa
- Suitable for: WB
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-Mycobacterium tuberculosis 16kDa antibody
See all Mycobacterium tuberculosis 16kDa primary antibodies -
Description
Biotin Rabbit polyclonal to Mycobacterium tuberculosis 16kDa -
Host species
Rabbit -
Conjugation
Biotin -
Specificity
Reacts with bacterium. -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Other species -
Immunogen
Recombinant full length protein corresponding to Mycobacterium tuberculosis 16kDa aa 30-159.
Sequence:AYPITGKLGSELTMTDTVGQVVLGWKVSDLKSSTAVIPGYPVAGQVWEAT ATVNAIRGSVTPAVSQFNARTADGINYRVLWQAAGPDTISGATIPQGEQS TGKIYFDVTGPSPTIVAMNNGMEDLLIWEP
Database link: P9WIP1 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), 49% PBS, 0.03% Proclin 300 -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
>95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab193390 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use at an assay dependent concentration. Predicted molecular weight: 16 kDa. |
Target
-
Relevance
Mycobacterium tuberculosis is the most common cause of tuberculosis. Primary infection begins with inhalation of 1 to 10 aerosolised bacilli. The pathogenicity of the organism is determined by its ability to escape host immune responses as well as eliciting delayed hypersensitivity. Alveolar macrophages engulf the invading cells but are unable to mount an effective defense. Several virulence factors are responsible for this apparent failure; most notably in the mycobacterial cell wall are the cord factor, lipoarabinomannan, and the 65 kd heat shock protein or HSP65. The emergence of new strains of resistant Mycobacterium tuberculosis has created new interest in clinical diagnosis. Studies have shown immunohistochemical techniques to be superior to conventional special stains. Thus the demonstration of mycobacterial antigens are not only useful in establishing mycobacterial aetiology, but can also be used as an alternative method to the conventional Ziehl-Neelsen method. -
Cellular localization
Secreted -
Alternative names
- 16 kDa antigen antibody
- 16 kDa immunoprotective extracellular protein antibody
- Antigen MPT63 antibody
see all
References (0)
ab193390 has not yet been referenced specifically in any publications.
