Biotin Anti-NMDAR1 antibody [N308/48] (ab183434)
Key features and details
- Biotin Mouse monoclonal [N308/48] to NMDAR1
- Suitable for: WB
- Reacts with: Mouse, Rat, Human
- Conjugation: Biotin
- Isotype: IgG1
Overview
-
Product name
Biotin Anti-NMDAR1 antibody [N308/48]
See all NMDAR1 primary antibodies -
Description
Biotin Mouse monoclonal [N308/48] to NMDAR1 -
Host species
Mouse -
Conjugation
Biotin -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Fusion protein corresponding to Rat NMDAR1 aa 42-361 (extracellular). NP_058706.1
Sequence:FREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISSQVYAIL VSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTV PPYSHQSSVWFEMMRVYNWNHIILLVSDDHEGRAAQKRLETLLEERESKA EKVLQFDPGTKNVTALLMEARELEARVIILSASEDDAATVYRAAAMLNMT GSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESAHISDAVGVVAQA VHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFN EDGDRKFANYSIMNLQNRKL
Database link: P35439 -
Positive control
- Rat brain tissue lysate
-
General notes
The clone number has been updated from S308-48 to N308/48, both clone numbers name the same antibody clone.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 49% PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
N308/48 -
Isotype
IgG1 -
Research areas
Associated products
-
Alternative Versions
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab183434 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 105 kDa. 1 µg/ml of ab183434 is sufficient for detection of NMDAR1 in 20µg of rat brain membrane lysate. |
Target
-
Function
NMDA receptor subtype of glutamate-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Mediated by glycine. This protein plays a key role in synaptic plasticity, synaptogenesis, excitotoxicity, memory acquisition and learning. It mediates neuronal functions in glutamate neurotransmission. Is involved in the cell surface targeting of NMDA receptors. -
Sequence similarities
Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. NR1/GRIN1 subfamily. -
Post-translational
modificationsNMDA is probably regulated by C-terminal phosphorylation of an isoform of NR1 by PKC. Dephosphorylated on Ser-897 probably by protein phosphatase 2A (PPP2CB). Its phosphorylated state is influenced by the formation of the NMDAR-PPP2CB complex and the NMDAR channel activity. -
Cellular localization
Cell membrane. Cell junction > synapse > postsynaptic cell membrane. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Enriched in post-synaptic plasma membrane and post-synaptic densities. - Information by UniProt
-
Database links
- Entrez Gene: 2902 Human
- Entrez Gene: 14810 Mouse
- Entrez Gene: 24408 Rat
- Omim: 138249 Human
- SwissProt: Q05586 Human
- SwissProt: P35438 Mouse
- SwissProt: P35439 Rat
- Unigene: 558334 Human
see all -
Alternative names
- GluN1 antibody
- Glutamate [NMDA] receptor subunit zeta-1 antibody
- Glutamate receptor ionotropic N methyl D aspartate 1 antibody
see all
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab183434 has not yet been referenced specifically in any publications.