Biotin Anti-RBP4 antibody (ab193151)
Key features and details
- Biotin Rabbit polyclonal to RBP4
- Suitable for: IHC-P
- Reacts with: Human
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-RBP4 antibody
See all RBP4 primary antibodies -
Description
Biotin Rabbit polyclonal to RBP4 -
Host species
Rabbit -
Conjugation
Biotin -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human RBP4 aa 20-201. Full length chain without signal peptide.
Sequence:RDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETG QMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGN DDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKI VRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Database link: P02753 -
Positive control
- IHC-P: Human liver cancer tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark. -
Storage buffer
pH: 7.40
Constituents: 49% PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
>95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab193151 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. |
Target
-
Function
Delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin, this prevents its loss by filtration through the kidney glomeruli. -
Involvement in disease
Defects in RBP4 are a cause of retinol-binding protein deficiency (RBP deficiency) [MIM:180250]. This condition causes night vision problems. It produces a typical 'fundus xerophthalmicus', featuring a progressed atrophy of the retinal pigment epithelium. -
Sequence similarities
Belongs to the calycin superfamily. Lipocalin family. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 5950 Human
- Omim: 180250 Human
- SwissProt: P02753 Human
- Unigene: 50223 Human
-
Alternative names
- OTTHUMP00000020114 antibody
- OTTHUMP00000020115 antibody
- OTTHUMP00000020116 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Biotin Anti-RBP4 antibody (ab193151)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human liver cancer labeling RBP4 with ab193151 at dilution of 1/100.
Protocols
References (0)
ab193151 has not yet been referenced specifically in any publications.
