For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    biotin-vegfb-antibody-ab233505.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Angiogenesis Growth Factors VEGF VEGF
Share by email

Biotin Anti-VEGFB antibody (ab233505)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Biotin Anti-VEGFB antibody (ab233505)
  • Western blot - Biotin Anti-VEGFB antibody (ab233505)
  • Sandwich ELISA - Biotin Anti-VEGFB antibody (ab233505)

Key features and details

  • Biotin Rabbit polyclonal to VEGFB
  • Suitable for: Sandwich ELISA, WB
  • Reacts with: Recombinant fragment
  • Conjugation: Biotin
  • Isotype: IgG

You may also be interested in

Protein
Product image
Recombinant Human VEGFB protein (ab179970)
Protein
Product image
Streptavidin (HRP) (ab7403)

View more associated products

Overview

  • Product name

    Biotin Anti-VEGFB antibody
    See all VEGFB primary antibodies
  • Description

    Biotin Rabbit polyclonal to VEGFB
  • Host species

    Rabbit
  • Conjugation

    Biotin
  • Tested applications

    Suitable for: Sandwich ELISA, WBmore details
  • Species reactivity

    Reacts with: Recombinant fragment
    Predicted to work with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human VEGFB aa 22-207.
    Sequence:

    PVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPS CVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQ CECRPKKKDSAVKPDSPRPLCPRCTQHHQRPDPRTCRCRCRRRSFLRCQG RGLELNPDTCRCRKLRR


    Database link: P49765
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: Recombinant human VEGFB protein.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Lyophilized:For lot specific reconstitution information please contact our Scientific Support Team.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Storage buffer

    Constituent: PBS

    Filter sterilized
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233505 purified by affinity chromatography and then biotinylated.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cardiovascular
    • Angiogenesis
    • Growth Factors
    • VEGF
    • VEGF
    • Signal Transduction
    • Growth Factors/Hormones
    • VEGF
    • Neuroscience
    • Neurology process
    • Neurogenesis
    • Cancer
    • Growth factors
    • VEGF
    • Cancer
    • Invasion/microenvironment
    • Angiogenesis
    • Angiogenic growth factors

Associated products

  • Recombinant Protein

    • Recombinant Human VEGFB protein (ab179970)
  • Related Products

    • Recombinant Human VEGFB protein (ab179970)

Applications

Our Abpromise guarantee covers the use of ab233505 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Sandwich ELISA Use a concentration of 0.25 - 1 µg/ml.
WB Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 21 kDa.

Target

  • Function

    Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis.
  • Tissue specificity

    Expressed in all tissues except liver. Highest levels found in heart, skeletal muscle and pancreas.
  • Sequence similarities

    Belongs to the PDGF/VEGF growth factor family.
  • Post-translational
    modifications

    VEGF-B186 is O-glycosylated.
  • Cellular localization

    Secreted. Secreted but remains associated to cells or to the extracellular matrix unless released by heparin.
  • Target information above from: UniProt accession P49765 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 7423 Human
    • Omim: 601398 Human
    • SwissProt: P49765 Human
    • Unigene: 732095 Human
    • Unigene: 78781 Human
    • Form

      There are 2 isoforms produced by alternative splicing.
    • Alternative names

      • Vascular endothelial growth factor B antibody
      • Vascular endothelial growth factor-related factor antibody
      • VEGF B antibody
      • VEGF related factor antibody
      • VEGF-B antibody
      • VEGF-related factor antibody
      • Vegfb antibody
      • VEGFB_HUMAN antibody
      • VEGFL antibody
      • VRF antibody
      see all

    Images

    • Western blot - Biotin Anti-VEGFB antibody (ab233505)
      Western blot - Biotin Anti-VEGFB antibody (ab233505)
      Lanes 1-10 : Biotin Anti-VEGFB antibody (ab233505) at 0.2 µg/ml
      Lane 11 : Biotin Anti-VEGFB antibody (ab233505) at 0.2 µg

      Lane 1 : Recombinant human VEGFB protein, 250 ng
      Lane 2 : Recombinant human VEGFB protein, 125 ng
      Lane 3 : Recombinant human VEGFB protein, 62.5 ng
      Lane 4 : Recombinant human VEGFB protein, 31.25 ng
      Lane 5 : Recombinant human VEGFB protein, 15.625 ng
      Lane 6 : Recombinant human VEGFB protein, 7.8 ng
      Lane 7 : Recombinant human VEGFB protein, 3.9 ng
      Lane 8 : Recombinant human VEGFB protein, 1.95 ng
      Lane 9 : Recombinant human VEGFB protein, 0.98 ng
      Lane 10 : Recombinant human VEGFB protein, 0.49 ng
      Lane 11 : Recombinant human VEGFB protein, 0.24 ng

      Predicted band size: 21 kDa



      Reduced.

    • Western blot - Biotin Anti-VEGFB antibody (ab233505)
      Western blot - Biotin Anti-VEGFB antibody (ab233505)
      All lanes : Biotin Anti-VEGFB antibody (ab233505) at 0.2 µg/ml

      Lane 1 : Recombinant human VEGFB protein, 250 ng
      Lane 2 : Recombinant human VEGFB protein, 125 ng
      Lane 3 : Recombinant human VEGFB protein, 62.5 ng
      Lane 4 : Recombinant human VEGFB protein, 31.25 ng
      Lane 5 : Recombinant human VEGFB protein, 15.625 ng
      Lane 6 : Recombinant human VEGFB protein, 7.8 ng
      Lane 7 : Recombinant human VEGFB protein, 3.9 ng
      Lane 8 : Recombinant human VEGFB protein, 1.95 ng
      Lane 9 : Recombinant human VEGFB protein, 0.98 ng
      Lane 10 : Recombinant human VEGFB protein, 0.49 ng
      Lane 11 : Recombinant human VEGFB protein, 0.24 ng

      Predicted band size: 21 kDa



      Non-reduced.

    • Sandwich ELISA - Biotin Anti-VEGFB antibody (ab233505)
      Sandwich ELISA - Biotin Anti-VEGFB antibody (ab233505)

      ab233505, in conjunction with Anti-human VEGFB as a capture antibody, allows the detection of at least 2000-4000 pg/ml of Recombinant human VEGFB.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab233505? Please let us know so that we can cite the reference in this datasheet.

    ab233505 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab233505.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.