Biotin Anti-VEGFB antibody (ab233505)
Key features and details
- Biotin Rabbit polyclonal to VEGFB
- Suitable for: Sandwich ELISA, WB
- Reacts with: Recombinant fragment
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-VEGFB antibody
See all VEGFB primary antibodies -
Description
Biotin Rabbit polyclonal to VEGFB -
Host species
Rabbit -
Conjugation
Biotin -
Tested applications
Suitable for: Sandwich ELISA, WBmore details -
Species reactivity
Reacts with: Recombinant fragment
Predicted to work with: Human
-
Immunogen
Recombinant full length protein corresponding to Human VEGFB aa 22-207.
Sequence:PVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPS CVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQ CECRPKKKDSAVKPDSPRPLCPRCTQHHQRPDPRTCRCRCRRRSFLRCQG RGLELNPDTCRCRKLRR
Database link: P49765 -
Positive control
- WB: Recombinant human VEGFB protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:For lot specific reconstitution information please contact our Scientific Support Team. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark. -
Storage buffer
Constituent: PBS
Filter sterilized -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab233505 purified by affinity chromatography and then biotinylated. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab233505 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| Sandwich ELISA | Use a concentration of 0.25 - 1 µg/ml. | |
| WB | Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 21 kDa. |
Target
-
Function
Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis. -
Tissue specificity
Expressed in all tissues except liver. Highest levels found in heart, skeletal muscle and pancreas. -
Sequence similarities
Belongs to the PDGF/VEGF growth factor family. -
Post-translational
modificationsVEGF-B186 is O-glycosylated. -
Cellular localization
Secreted. Secreted but remains associated to cells or to the extracellular matrix unless released by heparin. - Information by UniProt
-
Database links
- Entrez Gene: 7423 Human
- Omim: 601398 Human
- SwissProt: P49765 Human
- Unigene: 732095 Human
- Unigene: 78781 Human
-
Form
There are 2 isoforms produced by alternative splicing. -
Alternative names
- Vascular endothelial growth factor B antibody
- Vascular endothelial growth factor-related factor antibody
- VEGF B antibody
see all
Images
-
Western blot - Biotin Anti-VEGFB antibody (ab233505)Lanes 1-10 : Biotin Anti-VEGFB antibody (ab233505) at 0.2 µg/ml
Lane 11 : Biotin Anti-VEGFB antibody (ab233505) at 0.2 µg
Lane 1 : Recombinant human VEGFB protein, 250 ng
Lane 2 : Recombinant human VEGFB protein, 125 ng
Lane 3 : Recombinant human VEGFB protein, 62.5 ng
Lane 4 : Recombinant human VEGFB protein, 31.25 ng
Lane 5 : Recombinant human VEGFB protein, 15.625 ng
Lane 6 : Recombinant human VEGFB protein, 7.8 ng
Lane 7 : Recombinant human VEGFB protein, 3.9 ng
Lane 8 : Recombinant human VEGFB protein, 1.95 ng
Lane 9 : Recombinant human VEGFB protein, 0.98 ng
Lane 10 : Recombinant human VEGFB protein, 0.49 ng
Lane 11 : Recombinant human VEGFB protein, 0.24 ng
Predicted band size: 21 kDaReduced.
-
Western blot - Biotin Anti-VEGFB antibody (ab233505)All lanes : Biotin Anti-VEGFB antibody (ab233505) at 0.2 µg/ml
Lane 1 : Recombinant human VEGFB protein, 250 ng
Lane 2 : Recombinant human VEGFB protein, 125 ng
Lane 3 : Recombinant human VEGFB protein, 62.5 ng
Lane 4 : Recombinant human VEGFB protein, 31.25 ng
Lane 5 : Recombinant human VEGFB protein, 15.625 ng
Lane 6 : Recombinant human VEGFB protein, 7.8 ng
Lane 7 : Recombinant human VEGFB protein, 3.9 ng
Lane 8 : Recombinant human VEGFB protein, 1.95 ng
Lane 9 : Recombinant human VEGFB protein, 0.98 ng
Lane 10 : Recombinant human VEGFB protein, 0.49 ng
Lane 11 : Recombinant human VEGFB protein, 0.24 ng
Predicted band size: 21 kDaNon-reduced.
-
Sandwich ELISA - Biotin Anti-VEGFB antibody (ab233505)ab233505, in conjunction with Anti-human VEGFB as a capture antibody, allows the detection of at least 2000-4000 pg/ml of Recombinant human VEGFB.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab233505 has not yet been referenced specifically in any publications.
