Anti-BLBP antibody (ab208167)

Rabbit polyclonal BLBP antibody. Validated in WB and tested in Human. Immunogen corresponding to recombinant full length protein.

Overview

  • Product name

  • Description

    Rabbit polyclonal to BLBP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human BLBP aa 1-132.
    Sequence:

    MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKV VIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDG KETNFVREIKDGKMVMTLTFGDVVAVRHYEKA


    Database link: O15540

  • Positive control

    • U87 lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 99% PBS, 0.05% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab208167 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 µg/ml. Predicted molecular weight: 15 kDa.

Target

  • Function

    B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers.
  • Tissue specificity

    Expressed in brain and other neural tissues.
  • Sequence similarities

    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain

    Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • B FABP antibody
    • B-FABP antibody
    • BFABP antibody
    • BLBP antibody
    • Brain lipid binding protein antibody
    • Brain lipid-binding protein antibody
    • Brain-type fatty acid-binding protein antibody
    • DKFZp547J2313 antibody
    • FABP 7 antibody
    • FABP7 antibody
    • FABP7_HUMAN antibody
    • FABPB antibody
    • Fatty Acid Binding Protein 7 antibody
    • Fatty acid binding protein 7 brain antibody
    • Fatty acid binding protein brain antibody
    • Fatty acid-binding protein 7 antibody
    • Fatty acid-binding protein, brain antibody
    • Mammary derived growth inhibitor related antibody
    • Mammary-derived growth inhibitor related antibody
    • MRG antibody
    • OTTHUMP00000017119 antibody
    see all

Images

  • Anti-BLBP antibody (ab208167) at 2 µg/ml + U87 lysate

    Predicted band size: 15 kDa

References

ab208167 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208167.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up