Overview

  • Product name

  • Description

    Rabbit polyclonal to BLMH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human BLMH aa 248-330.
    Sequence:

    ITPLEFYREHVKPLFNMEDKICLVNDPRPQHKYNKLYTVEYLSNMVGGRK TLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGK


    Database link: Q13867

  • Positive control

    • Human skin tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab204584 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded human skin tissue sections labeling BLMH with ab204584 at a 1/1000 dilution.

References

ab204584 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204584.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up