Overview

  • Product name

    Anti-Blood Group Kell Antigen antibody
    See all Blood Group Kell Antigen primary antibodies
  • Description

    Rabbit polyclonal to Blood Group Kell Antigen
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse Blood Group Kell Antigen aa 49-358. Expressed in E.coli. N-terminal tags.
    Sequence:

    IFRNCGPCPCETPVCMELLDHYLASGNRSVAPCTDFFSFACEKANGTSDS FQALTEENKSRLWRLLEAPGSWHLGSGEEKAFQFYNSCMDTDAIEASGSG PLIQIIEELGGWNITGNWTSLDFNQNLRLLMSQYGHFPFFRAYLRPHPAP PHTPIIQIDQPEFDILLQQEQEQKVYAQILREYVTYLNRLGTLLGSNPQE AQQHASWSIVFTSRLFQFLRPQQQQQAQDKLFHVVTIDELQEMAPAIDWL SCLQAIFTPMSLNSSQTLVVHDLDYLRNMSQLVEEGLLNHRESIQSYMIL GLVDTLSPAL


    Database link: Q9EQF2

  • Positive control

    • WB: Recombinant mouse Blood Group Kell Antigen; mouse spleen and testis lysates. IHC-P: Mouse testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231602 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 81 kDa.

Target

  • Function

    Zinc endopeptidase with endothelin-3-converting enzyme activity.
  • Sequence similarities

    Belongs to the peptidase M13 family.
  • Cellular localization

    Cell membrane. Spans the erythrocyte membrane, and is attached to the underlying cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD238 antibody
    • CD238 antigen antibody
    • ECE3 antibody
    • kel antibody
    • Kell blood group antibody
    • Kell blood group glycoprotein antibody
    • Kell blood group metallo endopeptidase antibody
    • Kell blood group metalloendopeptidase antibody
    • KELL NULL antibody
    • Kell protein antibody
    • KELL_HUMAN antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse testis tissue stained for Blood Group Kell Antigen using ab231602 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Blood Group Kell Antigen antibody (ab231602) at 2 µg/ml + Mouse testis lysate

    Predicted band size: 81 kDa

  • Anti-Blood Group Kell Antigen antibody (ab231602) at 2 µg/ml + Mouse spleen lysate

    Predicted band size: 81 kDa

  • Anti-Blood Group Kell Antigen antibody (ab231602) at 2 µg/ml + Recombinant mouse Blood Group Kell Antigen protein

    Predicted band size: 81 kDa

References

ab231602 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231602.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up