Overview

  • Product name

  • Description

    Rabbit polyclonal to BMP15
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse BMP15 aa 274-390. Expressed in E. coli. N-terminal tags.
    Sequence:

    SDASCPSQEHDGSVNNQCSLHPYKVSFHQLGWDHWIIAPRLYTPNYCKGI CTRVLPYGLNSPNHAIIQSLVNELVNHSVPQPSCVPYNFLPMSILLIETN GSILYKEYEGMIAQSCTCR


    Database link: Q9Z0L4

  • Positive control

    • IHC-P: Mouse liver, testis, brain and kidney tissues. WB: Recombinant mouse BMP15 protein; Mouse testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231261 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    May be involved in follicular development. Oocyte-specific growth/differentiation factor that stimulates folliculogenesis and granulosa cell (GC) growth.
  • Involvement in disease

    Defects in BMP15 are the cause of ovarian dysgenesis type 2 (ODG2) [MIM:300510]; also known as X-linked hypergonadotropic ovarian dysgenesis or hypergonadotropic ovarian failure due to ovarian dysgenesis. Ovarian dysgenesis leads to ovarian failure and accounts for about half of the cases of primary amenorrhea.
    Defects in BMP15 are the cause of premature ovarian failure type 4 (POF4) [MIM:300510]. An ovarian disorder defined as the cessation of ovarian function under the age of 40 years. It is characterized by oligomenorrhea or amenorrhea, in the presence of elevated levels of serum gonadotropins and low estradiol.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • BMP 15 antibody
    • BMP-15 antibody
    • BMP15 antibody
    • BMP15_HUMAN antibody
    • Bone morphogenetic protein 15 antibody
    • GDF 9B antibody
    • GDF-9B antibody
    • GDF9B antibody
    • Growth/differentiation factor 9B antibody
    • ODG2 antibody
    • POF4 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse testis tissue stained for BMP15 using ab231261 at 20 µg/mL in immunohistochemical analysis. DAB-staining.

  • Anti-BMP15 antibody (ab231261) at 1 µg/ml + Mouse testis tissue lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Developed using the ECL technique.
  • Formalin-fixed, paraffin-embedded mouse liver tissue stained for BMP15 using ab231261 at 20 µg/mL in immunohistochemical analysis. DAB-staining.

  • Formalin-fixed, paraffin-embedded mouse brain tissue stained for BMP15 using ab231261 at 20 µg/mL in immunohistochemical analysis. DAB-staining.

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for BMP15 using ab231261 at 20 µg/mL in immunohistochemical analysis. DAB-staining.

  • Anti-BMP15 antibody (ab231261) at 2 µg/ml + Recombinant mouse BMP15 protein

References

ab231261 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231261.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up