Overview

  • Product name

  • Description

    Rabbit polyclonal to BMP4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human, Zebrafish
    Predicted to work with: Rabbit, Cow, Deer
  • Immunogen

    Recombinant fragment corresponding to Human BMP4 aa 303-408.
    Sequence:

    KKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNST NHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVV EGCGCR


    Database link: P12644

  • Positive control

    • WB: HeLa and A549 cell lysate; Mouse kidney, liver, brain and skeletal muscle lysate; Rat liver and kidney lysate; Whole Zebrafish lysate. IHC-P: Human prostate cancer, lung, small intestine and appendix tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235114 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IHC-P 1/20 - 1/200.

Target

  • Function

    Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction.
  • Tissue specificity

    Expressed in the lung and lower levels seen in the kidney. Present also in normal and neoplastic prostate tissues, and prostate cancer cell lines.
  • Involvement in disease

    Defects in BMP4 are the cause of microphthalmia syndromic type 6 (MCOPS6) [MIM:607932]; also known as microphthalmia and pituitary anomalies or microphthalmia with brain and digit developmental anomalies. Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues (anophthalmia). In many cases, microphthalmia/anophthalmia occurs in association with syndromes that include non-ocular abnormalities. MCOPS6 is characterized by microphthalmia/anophthalmia associated with facial, genital, skeletal, neurologic and endocrine anomalies.
    Defects in BMP4 are the cause of non-syndromic orofacial cleft type 11 (OFC11) [MIM:600625]. Non-syndromic orofacial cleft is a common birth defect consisting of cleft lips with or without cleft palate. Cleft lips are associated with cleft palate in two-third of cases. A cleft lip can occur on one or both sides and range in severity from a simple notch in the upper lip to a complete opening in the lip extending into the floor of the nostril and involving the upper gum. OFC11 is an unusual anomaly consisting of a paramedian scar of the upper lip with an appearance suggesting that a typical cleft lip was corrected in utero.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • zgc:100779 antibody
    • BMP 2B antibody
    • BMP 4 antibody
    • BMP-2B antibody
    • BMP-4 antibody
    • BMP2B antibody
    • BMP2B1 antibody
    • BMP4 antibody
    • BMP4_HUMAN antibody
    • Bone morphogenetic protein 2B antibody
    • Bone morphogenetic protein 4 antibody
    • DVR4 antibody
    • MCOPS6 antibody
    • MGC100779 antibody
    • OFC11 antibody
    • zbmp-4 antibody
    • ZYME antibody
    see all

Images

  • All lanes : Anti-BMP4 antibody (ab235114) at 1/500 dilution

    Lane 1 : Rat liver lysate
    Lane 2 : A549 (human lung carcinoma cell line) cell lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human prostate cancer tissue stained for BMP4 using ab235114 at 1/100 dilution in immunohistochemical analysis.

     

  • Paraffin-embedded human appendix tissue stained for BMP4 using ab235114 at 1/600 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Primary antibody (1% BSA) was incubated at 4°C overnight. The primary antibody was detected by a biotinylated secondary antibody and visualized using a HRP conjugated SP system.

  • Paraffin-embedded human small intestine tissue stained for BMP4 using ab235114 at 1/600 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Primary antibody (1% BSA) was incubated at 4°C overnight. The primary antibody was detected by a biotinylated secondary antibody and visualized using a HRP conjugated SP system.

  • All lanes : Anti-BMP4 antibody (ab235114) at 1/500 dilution

    Lane 1 : Mouse brain lysate
    Lane 2 : Mouse skeletal muscle lysate
    Lane 3 : Whole Zebrafish lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
  • All lanes : Anti-BMP4 antibody (ab235114) at 1/500 dilution

    Lane 1 : Mouse kidney lysate
    Lane 2 : Mouse liver lysate
    Lane 3 : Rat liver lysate
    Lane 4 : Rat kidney lysate
    Lane 5 : Whole Zebrafish lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human lung tissue stained for BMP4 using ab235114 at 1/100 dilution in immunohistochemical analysis.

     

References

ab235114 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235114.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up