Anti-BMP8a/OP-2 antibody (ab154373)
Key features and details
- Rabbit polyclonal to BMP8a/OP-2
- Suitable for: WB, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-BMP8a/OP-2 antibody
See all BMP8a/OP-2 primary antibodies -
Description
Rabbit polyclonal to BMP8a/OP-2 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat -
Immunogen
Synthetic peptide corresponding to Human BMP8a/OP-2 aa 336-402 (C terminal).
Sequence:FPLDSCMNATNHAILQSLVHLMKPNAVPKACCAPTKLSATSVLYYDSSNN VILRKHRNMVVKACGCH
Database link: Q7Z5Y6 -
Positive control
- 293T, A431, H1299, HeLaS3 or Raji whole cell lysate; mouse ESC D3.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 1.21% Tris, 0.75% Glycine, 10% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab154373 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/3000. Predicted molecular weight: 45 kDa.
|
|
ICC/IF |
1/100 - 1/1000.
|
Notes |
---|
WB
1/500 - 1/3000. Predicted molecular weight: 45 kDa. |
ICC/IF
1/100 - 1/1000. |
Target
-
Function
Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis. -
Sequence similarities
Belongs to the TGF-beta family. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 353500 Human
- Entrez Gene: 12163 Mouse
- Entrez Gene: 680931 Rat
- SwissProt: Q7Z5Y6 Human
- SwissProt: P34821 Mouse
- Unigene: 472497 Human
- Unigene: 439749 Mouse
-
Alternative names
- BMP-8A antibody
- BMP8 antibody
- Bmp8a antibody
see all
Images
-
All lanes : Anti-BMP8a/OP-2 antibody (ab154373) at 1/500 dilution
Lane 1 : H1299 whole cell lysate
Lane 2 : Raji whole cell lysate
Lysates/proteins at 30 µg per lane.
Predicted band size: 45 kDa
7.5% SDS PAGE -
Immunofluorescence analysis of paraformaldehyde-fixed mouse ESC D3, labeling BMP8a/OP-2 using ab154373 at 1/200 dilution. Lower panel co-stained with Hoechst 33342.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab154373 has not yet been referenced specifically in any publications.