Overview

  • Product name

  • Description

    Rabbit polyclonal to BMPER
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human BMPER aa 501-550 (C terminal).
    Sequence:

    NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV

  • Positive control

    • Fetal heart lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab75183 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 76 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 5 µg/ml.

Target

  • Function

    Inhibitor of bone morphogenetic protein (BMP) function, it may regulate BMP responsiveness of osteoblasts and chondrocytes.
  • Tissue specificity

    Highly expressed in lung, and brain and also in primary chondrocytes.
  • Involvement in disease

    Defects in BMPER are the cause of diaphanospondylodysostosis (DSD) [MIM:608022]. A rare, recessively inherited, perinatal lethal skeletal disorder. The primary skeletal characteristics of the phenotype include a small chest, abnormal vertebral segmentation, and posterior rib gaps containing incompletely differentiated mesenchymal tissue. Consistent craniofacial features include ocular hypertelorism, epicanthal folds, a depressed nasal bridge with a short nose, and low-set ears. The most commonly described extraskeletal finding is nephroblastomatosis with cystic kidneys, but other visceral findings have been described in some cases.
  • Sequence similarities

    Contains 1 TIL (trypsin inhibitory-like) domain.
    Contains 5 VWFC domains.
    Contains 1 VWFD domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • BMP binding endothelial regulator antibody
    • BMP binding endothelial regulator precursor protein antibody
    • BMP-binding endothelial regulator protein antibody
    • BMPER antibody
    • BMPER_HUMAN antibody
    • Bone morphogenetic protein binding endothelial cell precursor derived regulator antibody
    • Bone morphogenetic protein-binding endothelial cell precursor-derived regulator antibody
    • CRIM3 antibody
    • Crossveinless 2 antibody
    • CV 2 antibody
    • CV2 antibody
    • hCV2 antibody
    • Protein crossveinless 2 antibody
    • Protein crossveinless-2 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung tissue labelling BMPER with ab75183 at 5µg/ml.

  • Anti-BMPER antibody (ab75183) at 1 µg/ml (in 5% skim milk / PBS buffer) + Fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 76 kDa
    Observed band size: >90 kDa
    why is the actual band size different from the predicted?

References

This product has been referenced in:

  • Huan C  et al. Methylation-mediated BMPER expression in fibroblast activation in vitro and lung fibrosis in mice in vivo. Sci Rep 5:14910 (2015). WB, IHC . Read more (PubMed: 26442443) »
See 1 Publication for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (stomach)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: TRIS-EDTA Buffer pH 9,0
Permeabilization
Yes - Wash Buffer from Dako with Tween
Specification
stomach
Fixative
Paraformaldehyde

Mr. Rudolf Jung

Verified customer

Submitted Oct 30 2018

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Rat Tissue sections (kidney)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: TRIS-EDTA Buffer pH 9,0
Permeabilization
Yes - Wash Buffer from Dako with Tween
Specification
kidney
Fixative
Paraformaldehyde

Mr. Rudolf Jung

Verified customer

Submitted Oct 30 2018

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (kidney)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: TRIS-EDTA Buffer pH 9,0
Permeabilization
Yes - Wash Buffer from Dako with Tween
Specification
kidney
Fixative
Paraformaldehyde

Mr. Rudolf Jung

Verified customer

Submitted Oct 30 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up