Overview

  • Product name

  • Description

    Rabbit polyclonal to BNC1/BNC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human BNC1/BNC aa 779-866.
    Sequence:

    LSQEALESSEDHFRAAYLLKDVAKEAYQDVAFTQQASQTSVIFKGTSRMG SLVYPITQVHSASLESYNSGPLSEGTILDLSTTSSMKS


    Database link: Q01954

  • Positive control

    • HaCaT cells.
  • General notes

     This product was previously labelled as BNC1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab221114 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Likely to be a transcription factor specific for squamous epithelium and for the constituent keratinocytes at a stage either prior to or at the very beginning of terminal differentiation. May play a role in the differentiation of spermatozoa and oocytes.
  • Tissue specificity

    Expressed in epidermis, testis and foreskin, and to a lower extent in thymus, spleen, mammary glands, placenta, brain and heart.
  • Sequence similarities

    Contains 6 C2H2-type zinc fingers.
  • Post-translational
    modifications

    Phosphorylation on Ser-537 and Ser-541 leads to cytoplasmic localization.
  • Cellular localization

    Nucleus. Cytoplasm. Relocates to the midpiece of the flagellum during late spermiogenesis in spermatids.
  • Information by UniProt
  • Database links

  • Alternative names

    • AI047752 antibody
    • AW546376 antibody
    • basonuclin 1 antibody
    • BNC antibody
    • Bnc1 antibody
    • BNC1_HUMAN antibody
    • BSN1 antibody
    • HsT19447 antibody
    • zinc finger protein basonuclin antibody
    • Zinc finger protein basonuclin-1 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized HaCaT cells labeling BNC1/BNC with ab221114 at 4 µg/ml (green).

References

ab221114 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221114.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up