Overview

  • Product name

    Anti-BNP antibody [C10]
    See all BNP primary antibodies
  • Description

    Mouse monoclonal [C10] to BNP
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Mouse BNP aa 27-121. Two N-terminal tags, His-tag and SUMO-tag. Expressed in E. coli. Full length mature chain without signal peptide.
    Sequence:

    YPLGSPSQSPEQFKMQKLLELIREKSEEMAQRQLLKDQGLTKEHPKRVLR SQGSTLRVQQRPQNSKVTHISSCFGHKIDRIGSVSRLGCNALKLL


    Database link: P40753-1

  • Positive control

    • WB: Recombinant mouse BNP protein; Rat heart and testis tissue. IHC-P: Mouse kidney, testis, liver and brain tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab239510 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 30 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml.

Target

  • Relevance

    Brain natriuretic peptide (BNP) circulates in blood as a peptide hormone with natriuretic, vasodilatory and renin inhibitory properties. BNP is secreted predominantly by the left ventricular myocytes in response to volume expansion and pressure overload. BNP belongs to a family of structurally similar peptide hormones, which includes atrial natriuretic peptide (ANP), BNP, C type natriuretic peptide (CNP) and urodilatin. These peptides are characterized by a common 17 amino acid ring structure with a disulfide bond between two cystein residues. This ring structure shows high homology between different natriuretic peptides (eleven of the 17 amino acid residues are homologous in the ring of each of the natriuretic peptides). BNP is a 32 amino acid peptide with disulfide bond between the cysteine residues Cys10 and Cys26. In earlier studies it has been demonstrated that BNP concentration in blood increases with the severity of congestive heart failure. Quantitative measurement of BNP in blood provides an objective indicator of congestive heart failure severity.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • BNP(1-28) antibody
    • BNP(1-29) antibody
    • BNP(1-30) antibody
    • BNP(1-32) antibody
    • BNP(2-31) antibody
    • BNP(3-29) antibody
    • BNP(3-30) antibody
    • BNP(3-32) antibody
    • BNP(4-27) antibody
    • BNP(4-29) antibody
    • BNP(4-30) antibody
    • BNP(4-31) antibody
    • BNP(4-32) antibody
    • BNP(5-29) antibody
    • BNP(5-31) antibody
    • BNP(5-32) antibody
    • Brain natriuretic peptide 32 antibody
    • Brain type natriuretic peptide antibody
    • Gamma brain natriuretic peptide antibody
    • Natriuretic peptide B antibody
    • Natriuretic peptide precursor B antibody
    • natriuretic peptide, brain type antibody
    • Natriuretic peptides B antibody
    • natriuretic protein antibody
    • NPPB antibody
    see all

Images

  • All lanes : Anti-BNP antibody [C10] (ab239510) at 2 µg/ml

    Lane 1 : Rat heart tissue lysate
    Lane 2 : Rat testis tissue lysate

    Secondary
    All lanes : HRP-Linked Rabbit Anti-Mouse IgG at 1/5000 dilution
  • Formalin-fixed, paraffin-embedded mouse cerebrum tissue stained for BNP with ab239510 at 30 µg/ml in immunohistochemical analysis. DAB staining. HRP-Goat Anti-Mouse IgG secondary antibody used at 2 µg/ml.

  • Formalin-fixed, paraffin-embedded mouse liver tissue stained for BNP with ab239510 at 30 µg/ml in immunohistochemical analysis. DAB staining. HRP-Goat Anti-Mouse IgG secondary antibody used at 2 µg/ml.

  • Formalin-fixed, paraffin-embedded mouse testis tissue stained for BNP with ab239510 at 30 µg/ml in immunohistochemical analysis. DAB staining. HRP-Goat Anti-Mouse IgG secondary antibody used at 2 µg/ml.

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for BNP with ab239510 at 30 µg/ml in immunohistochemical analysis. DAB staining. HRP-Goat Anti-Mouse IgG secondary antibody used at 2 µg/ml.

  • Anti-BNP antibody [C10] (ab239510) at 5 µg/ml + Recombinant mouse BNP protein

References

ab239510 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239510.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up