Overview

  • Product name

  • Description

    Rabbit polyclonal to BOC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human BOC aa 455-505 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    VGPASPQCPGEKGQGAPAEAPIILSSPRTSKTDSYELVWRPRHEGSGRAP I


    Database link: Q9BWV1

  • Positive control

    • Rat muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab217007 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

(Using a fluorescent secondary antibody).

Target

  • Relevance

    Brother of CDO (BOC) interacts with Hedgehog (Hh) via a specific FNIII domain and belongs to the Ihog (interference hedgehog) family of proteins. Zebrafish BOC is expressed predominantly in the developing neural plate and later in the neural tube and developing brain.
  • Cellular localization

    Cell membrane; Single pass type I membrane protein. Note: Enriched at sites of cell-cell contact.
  • Database links

  • Alternative names

    • BOC cell adhesion associated oncogene regulated antibody
    • Boc homolog (mouse) antibody
    • Boc homolog antibody
    • Brother of CDO antibody
    • Brother of CDON antibody
    • CDON2 antibody
    • Cell adhesion associated oncogene regulated 2 antibody
    • Protein BOC antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat muscle tissue labeling BOC with ab217007 at 1/200 dilution, overnight at 4°C. The secondary antibody was Goat anti-rabbit IgG, Cy3 conjugated at 1/200 dilution for 40 minutes at 37°C.

References

ab217007 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
Flow Cytometry
Sample
Mouse Cell (small cell lung cancer cell line 16T)
Permeabilization
No
Gating Strategy
single cells with FSC and SSC, live cells with low DAPI, positive/negative cells with PI filter set, anti-CD24 as positive control
Specification
small cell lung cancer cell line 16T
Preparation
Cell harvesting/tissue preparation method: cells grow as floating spheres. Collect by spinning, dissociate spheres with TrypLE, single cell through 40um cell strainer
Sample buffer: PBS + 10% FBS
Fixation
none

Abcam user community

Verified customer

Submitted Jul 10 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up