Overview

  • Product name

  • Description

    Rabbit polyclonal to BOG
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Human BOG aa 1-186.
    Sequence:

    MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITA RESIWLPFMETELHCDEKTIIIGHSSGAIAAMRYAETHRVYAIVLVSAYT SDLGDENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPFLPWKEQQEVA DRLETKLHKFTDCGHFQNTEFHELITVVKSLLKVPA


    Database link: O75884

  • Positive control

    • WB: A-375 whole cell lysate. IHC-P: Human kidney and testis tissue.
  • General notes

    Previously labelled as RBBP9. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235511 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 21 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    May play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1.
  • Tissue specificity

    Widely expressed. Expressed at higher levels in tumor tissues than in normal tissues.
  • Sequence similarities

    Belongs to the RBBP9 family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • B5T overexpressed gene protein antibody
    • B5T-overexpressed gene protein antibody
    • BOG antibody
    • Bog protein antibody
    • MGC9236 antibody
    • OTTHUMP00000030360 antibody
    • Protein BOG antibody
    • Putative hydrolase RBBP9 antibody
    • RBBP 10 antibody
    • RBBP 9 antibody
    • RBBP-10 antibody
    • RBBP-9 antibody
    • RBBP10 antibody
    • RBBP9 antibody
    • RBBP9_HUMAN antibody
    • Retinoblastoma binding protein 10 antibody
    • Retinoblastoma binding protein 9 antibody
    • Retinoblastoma-binding protein 10 antibody
    • Retinoblastoma-binding protein 9 antibody
    • Retinoma binding protein 9 antibody
    see all

Images

  • Anti-BOG antibody (ab235511) at 1/500 dilution + A-375 (Human malignant melanoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit at 1/10000 dilution

    Predicted band size: 21 kDa

  • Paraffin-embedded human kidney tissue stained for BOG using ab235511 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for BOG using ab235511 at 1/100 dilution in immunohistochemical analysis.

References

ab235511 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235511.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up