Overview

  • Product name

    Anti-BOG antibody [OTI4E1]
    See all BOG primary antibodies
  • Description

    Mouse monoclonal [OTI4E1] to BOG
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human BOG aa 1-186. Produced in HEK-293T cells (NP_006597).
    Sequence:

    MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITA RESIWLPFMETELHCDEKTIIIGHSSGAIAAMRYAETHRVYAIVLVSAYT SDLGDENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPFLPWKEQQEVA DRLETKLHKFTDCGHFQNTEFHELITVVKSLLKVPA


    Database link: O75884

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY BOG cDNA. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY BOG cDNA.
  • General notes

    Clone OTI4E1 (formerly 4E1).

    Previously labelled as RBBP9. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant by affinity chromatography.
  • Clonality

    Monoclonal
  • Clone number

    OTI4E1
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab118023 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500. Predicted molecular weight: 21 kDa.
ICC/IF 1/100.

Target

  • Function

    May play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1.
  • Tissue specificity

    Widely expressed. Expressed at higher levels in tumor tissues than in normal tissues.
  • Sequence similarities

    Belongs to the RBBP9 family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • B5T overexpressed gene protein antibody
    • B5T-overexpressed gene protein antibody
    • BOG antibody
    • Bog protein antibody
    • MGC9236 antibody
    • OTTHUMP00000030360 antibody
    • Protein BOG antibody
    • Putative hydrolase RBBP9 antibody
    • RBBP 10 antibody
    • RBBP 9 antibody
    • RBBP-10 antibody
    • RBBP-9 antibody
    • RBBP10 antibody
    • RBBP9 antibody
    • RBBP9_HUMAN antibody
    • Retinoblastoma binding protein 10 antibody
    • Retinoblastoma binding protein 9 antibody
    • Retinoblastoma-binding protein 10 antibody
    • Retinoblastoma-binding protein 9 antibody
    • Retinoma binding protein 9 antibody
    see all

Images

  • All lanes : Anti-BOG antibody [OTI4E1] (ab118023) at 1/500 dilution

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY RBBP9 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 21 kDa

  • pCMV6-ENTRY BOG cDNA transfected COS-7 (African green monkey kidney fibroblast-like cell line) cells stained for BOG using ab118023 at a 1/100 dilution in ICC/IF.

References

ab118023 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab118023.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up