Overview

  • Product name

    Anti-Bone marrow stromal cell antigen 1 antibody
    See all Bone marrow stromal cell antigen 1 primary antibodies
  • Description

    Rabbit polyclonal to Bone marrow stromal cell antigen 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Bone marrow stromal cell antigen 1 aa 29-293.
    Sequence:

    GARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVAL DKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMP LSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQ YSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMH EIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHP DCALKSAAAATQRKA


    Database link: Q10588

  • Positive control

    • IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Synthesizes the second messagers cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate, the former a second messenger that elicits calcium release from intracellular stores. May be involved in pre-B-cell growth.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the ADP-ribosyl cyclase family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADP ribosyl cyclase 2 antibody
    • ADP-ribosyl cyclase 2 antibody
    • ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2 antibody
    • Bone marrow stromal antigen 1 antibody
    • Bone marrow stromal cell antigen 1 antibody
    • BST 1 antibody
    • BST-1 antibody
    • BST1 antibody
    • BST1_HUMAN antibody
    • cADPr hydrolase 2 antibody
    • CD157 antibody
    • CD157 antigen antibody
    • Cyclic ADP ribose hydrolase 2 antibody
    • Cyclic ADP-ribose hydrolase 2 antibody
    • NAD(+) nucleosidase antibody
    • OTTHUMP00000217617 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for Bone marrow stromal cell antigen 1 using ab235786 at 1/100 dilution in immunohistochemical analysis.

References

ab235786 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up