Overview

  • Product name

    Anti-Bone Sialoprotein antibody - BSA and Azide free
    See all Bone Sialoprotein primary antibodies
  • Description

    Rabbit polyclonal to Bone Sialoprotein - BSA and Azide free
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Full length native protein (purified) corresponding to Human Bone Sialoprotein aa 1-317. Immunogen prepared from bone extract.
    Sequence:

    MKTALILLSILGMACAFSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAY FYPHLKRFPVQGSSDSSEENGDDSSEEEEEEEETSNEGENNEESNEDEDS EAENTTLSATTLGYGEDATPGTGYTGLAAIQLPKKAGDITNKATKEKESD EEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNGEE GEEESVTGANAEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPP FGKTTTVEYEGEYEYTGANEYDNGYEIYESENGEPRGDNYRAYEDEYSYF KGQGYDGYDGQNYYHHQ


    Database link: P21815

Properties

Applications

Our Abpromise guarantee covers the use of ab195426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC 1/100.
IHC-P Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 35 kDa.

Target

  • Function

    Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Promotes Arg-Gly-Asp-dependent cell attachment.
  • Post-translational
    modifications

    N-glycosylated; glycans consist of sialated and core-fucosylated bi-, tri- and tetraantennary chains.
    O-glycosylated at eight sites; mucin-type glycans contain Gal, GlcNAc, GalNAc and terminal NeuAc.
    Sulfated on either Tyr-313 or Tyr-314.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • BNSP antibody
    • Bone sialoprotein 2 antibody
    • Bone sialoprotein II antibody
    • BSP antibody
    • BSP II antibody
    • BSPII antibody
    • Cell binding sialoprotein antibody
    • Cell-binding sialoprotein antibody
    • IBSP antibody
    • Integrin binding sialoprotein antibody
    • Integrin-binding sialoprotein antibody
    • SIAL_HUMAN antibody
    • SPII antibody
    see all

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab195426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up