Overview

  • Product name

  • Description

    Rabbit polyclonal to Bora
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Bora aa 75-559.
    Sequence:

    DIHRQALYLSHSRIDKDVEDKRQKAIEEFFTKDVIVPSPWTDHEGKQLSQ CHSSKCTNINSDSPVGKKLTIHSEKSDAACQTLLSLPVDFNLENILGDYF RADEFADQSPGNLSSSSLRRKLFLDGNGSISDSLPSASPGSPHSGVQTSL EMFYSIDLSPVKCRSPLQTPSSGQFSSSPIQASAKKYSLGSITSPSPISS PTFSPIEFQIGETPLSEQRKFTVHSPDASSGTNSNGITNPCIRSPYIDGC SPIKNWSPMRLQMYSGGTQYRTSVIQIPFTLETQGEDEEDKENIPSTDVS SPAMDAAGIHLRQFSNEASTHGTHLVVTAMSVTQNQSSASEKELALLQDV EREKDNNTVDMVDPIEIADETTWIKEPVDNGSLPMTDFVSGIAFSIENSH MCMSPLAESSVIPCESSNIQMDSGYNTQNCGSNIMDTVGAESYCKESDAQ TCEVESKSQAFNMKQDHTTQRCWMKTASPFQCSSP


    Database link: Q6PGQ7

Properties

Applications

Our Abpromise guarantee covers the use of ab188241 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent concentration.

Use 5 µl.

ICC/IF 1/2000.
WB Use at an assay dependent concentration. Predicted molecular weight: 61 kDa.

Target

  • Function

    Required for the activation of Aurora-A (AURKA/STK6) at the onset of mitosis.
  • Sequence similarities

    Belongs to the BORA family.
  • Post-translational
    modifications

    Phosphorylated by AURKA/STK6.
  • Information by UniProt
  • Database links

  • Alternative names

    • Aurora borealis antibody
    • bora antibody
    • bora, aurora kinase A activator antibody
    • BORA_HUMAN antibody
    • C13orf34 antibody
    • Chromosome 13 open reading frame 34 antibody
    • FLJ22624 antibody
    • HsBora antibody
    • Protein aurora borealis antibody
    • RP11-342J4.2 antibody
    see all

Images

  • Western blot analysis (using ab188241 at 1/2000) after immunoprecipitation of U20S cell extracts.

    Lane 1: Input

    Lane 2: IP using a control serum

    Lane 3: IP using 5 µl of ab188241 + Protein A sepharose

     

  • Immunofluorescent analysis of 3% PFA-fixed  U2OS cells labeling Bora with ab188241 at 1/2000 dilution (green). In red an antibody recognizing Cyclin B, and blue DAPI staining.

References

ab188241 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188241.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up