Overview

  • Product name

    Anti-Bovine Serum Albumin antibody
    See all Bovine Serum Albumin primary antibodies
  • Description

    Rabbit polyclonal to Bovine Serum Albumin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ELISA, IHC-Fr, WBmore details
  • Species reactivity

    Reacts with: Cow
  • Immunogen

    Full length protein corresponding to Cow Bovine Serum Albumin aa 1-607. Antisera to bovine albumin was raised by repeated immunisations of rabbits with highly purified bovine albumin.
    Sequence:

    MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIA FSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCK VASLRETYGDMADCCEKQEP ERNECFLSHKDDSPDLPKLKPDPNTLCD EFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKG ACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPK AEFVEVTLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLK ECCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAF LGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDK LKHLVDEPQNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEV SRSLGKVGTRCCTKPESERMPCTEDYLSLIL NRLCVLHEKTPVSEKVT KCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEKQIK KQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK LVVSTQTALA


    Database link: P02769

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% PBS
  • Purity

    Whole antiserum
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186531 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/20000 - 1/100000.
IHC-Fr 1/1000 - 1/5000.
WB 1/2000 - 1/10000. Predicted molecular weight: 69 kDa.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • alb antibody
    • ALBU_HUMAN antibody
    • Albumin (32 AA) antibody
    • Albumin (AA 34) antibody
    • Albumin antibody
    • BSA antibody
    • Cell growth inhibiting protein 42 antibody
    • Growth inhibiting protein 20 antibody
    • PRO0883 antibody
    • PRO0903 antibody
    • PRO1341 antibody
    • Serum albumin antibody
    see all

References

ab186531 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186531.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up