Overview

Description

  • Nature

    Native
  • Source

    Native
  • Amino Acid Sequence
    • Accession
    • Species

      Cow
    • Sequence

      MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIA FSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCK VASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEF KADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGAC LLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKAE FVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKE CCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFL GSFLYEYSRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKL KHLVDEPQNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVS RSLGKVGTRCCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTKCC TESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEKQIKKQT ALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVV STQTALA
    • Molecular weight

      69 kDa
    • Amino acids

      1 to 607

Specifications

Our Abpromise guarantee covers the use of ab131379 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Purity

    > 96 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

    ab131379 was treated with peroxynitrite which modifies tyrosine by acting as an oxidant to produce 3-nitrotyrosine along the length of the Bovine Serum Albumin protein.

    Product was previously marketed under the MitoSciences sub-brand.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Constituents: 0.61% Tris HCl, 15% Glycerol, 0.87% Sodium chloride

General Info

  • Alternative names

    • alb
    • ALBU_HUMAN
    • Albumin
    • Albumin (32 AA)
    • Albumin (AA 34)
    • BSA
    • Cell growth inhibiting protein 42
    • Growth inhibiting protein 20
    • PRO0883
    • PRO0903
    • PRO1341
    • Serum albumin
    see all
  • Information by UniProt

Images

  • All lanes: Anti-Nitrotyrosine antibody (ab110282) 0.4 µg/mL.

    Lane 1: Molecular weight marker
    Lane 2: BSA 100 ng
    Lane 3: BSA 25 ng
    Lane 4: Nitrated BSA 100 ng
    Lane 5: Nitrated BSA 50 ng
    Lane 6: Nitrated BSA 25 ng
    Lane 7: Nitrated BSA 12.5 ng
    Lane 8: Nitrated BSA 6.25 ng
    Lane 9: Nitrated BSA 3.125 ng

    Secondary antibody:
    Goat polyclonal to Mouse IgG – Pre-Adsorbed (HRP) at 1/6000
    developed using the ECL technique.

    Performed under reducing conditions.

    Predicted band size: 69,293 Da
    Observed band size: 69 kDa

    Exposure time: 5 minutes

  • Lane 1: Nitrated Bovine Serum Albumin protein (50 ng)
    Lane 2: Molecular weight marker 
    Lane 3: Bovine Serum Albumin protein (50 ng)

    Gel: 4-20% acrylamide separation gel

    Predicted band size: 69 kDa

References

ab131379 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131379.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up