Overview

  • Product name
  • Description
    Rabbit polyclonal to BOZ-F1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse, Guinea pig, Cow, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human BOZ-F1 aa 350-400. The exact sequence is proprietary.
    Sequence:

    LTGQVVQEGTRRYRLCNECLAEFGIDSLPIDLEAEQHLMSPSDGDKDSRW H


    Database link: Q96BR9

  • Positive control
    • HeLa, Jurkat or 293T lysate.
  • General notes

    Previously labelled as ZBTB8A. 

Properties

Applications

Our Abpromise guarantee covers the use of ab176683 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 50 kDa.

Target

  • Function
    May be involved in transcriptional regulation.
  • Sequence similarities
    Contains 1 BTB (POZ) domain.
    Contains 2 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • BOZ-F1 antibody
    • BOZF1 antibody
    • BTB/POZ and zinc-finger domain-containing factor antibody
    • BTB/POZ and zinc-finger domains factor on chromosome 1 antibody
    • ZBT8A_HUMAN antibody
    • Zbtb8a antibody
    • Zinc finger and BTB domain-containing protein 8A antibody
    see all

Images

  • Detection of Human BOZ-F1 by Western Blot of Immunoprecipitates. 

    ab176683 at 1 µg/ml, staining BOZ-F1 in HeLa whole cell lysate immunoprecipitated using ab176683 at 6 µg/mg lysate (1 mg/IP; 20% of IP loaded/lane). Detection: Chemiluminescence with an exposure time of 30 seconds.

  • All lanes : Anti-BOZ-F1 antibody (ab176683) at 0.04 µg/ml

    Lane 1 : HeLa lysate at 50 µg
    Lane 2 : HeLa lysate at 15 µg
    Lane 3 : Jurkat lysate at 50 µg
    Lane 4 : 293T lysate at 50 µg

    Predicted band size: 50 kDa


    Exposure time: 3 minutes

References

ab176683 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176683.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up