Overview

  • Product name

    Anti-BPHL antibody
  • Description

    Rabbit polyclonal to BPHL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human BPHL aa 188-270.
    Sequence:

    RTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPAL IVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEG


    Database link: Q86WA6

  • Positive control

    • Human kidney tissue. PC3 cells. RT-4 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab204229 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 33 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol.
  • Tissue specificity

    Expressed at high levels in liver and kidney and lower levels in heart, intestine and skeletal muscle.
  • Sequence similarities

    Belongs to the AB hydrolase superfamily. Lipase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • Biphenyl hydrolase like antibody
    • Biphenyl hydrolase related antibody
    • biphenyl hydrolase-like (serine hydrolase) antibody
    • Biphenyl hydrolase-like protein antibody
    • Biphenyl hydrolase-related protein antibody
    • Bph-rp antibody
    • Bphl antibody
    • BPHL_HUMAN antibody
    • Bphrp antibody
    • Breast epithelial mucin associated antigen antibody
    • Breast epithelial mucin-associated antigen antibody
    • MCNAA antibody
    • Mucin-associated antigen antibody
    • VACVase antibody
    • Valacyclovir hydrolase antibody
    • Valacyclovirase antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue, labeling BPHL using ab204229 at a 1/50 dilution.

  • Immunofluorescence analysis of paraformaldehyde-fixed PC3 cells labeling BPHL using ab204229 at 4 µg/ml.

  • Anti-BPHL antibody (ab204229) at 1/100 dilution + RT-4 cell lysate

    Developed using the ECL technique.

    Predicted band size: 33 kDa

References

ab204229 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204229.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up