Anti-BPIFB1 antibody (ab203350)
Key features and details
- Rabbit polyclonal to BPIFB1
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-BPIFB1 antibody
See all BPIFB1 primary antibodies -
Description
Rabbit polyclonal to BPIFB1 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Synthetic peptide within Human BPIFB1 aa 15-65 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:AATLIQATLSPTAVLILGPKVIKEKLTQELKDHNATSILQQLPLLSAMRE K
Database link: Q8TDL5 -
Positive control
- Human colon carcinoma lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 1% BSA -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab203350 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/100 - 1/1000. Detects a band of approximately 53 kDa (predicted molecular weight: 52 kDa). |
Target
-
Function
May play a role in innate immunity in mouth, nose and lungs. -
Tissue specificity
Detected in trachea, nasal septal epithelium and lung. -
Sequence similarities
Belongs to the BPI/LBP/Plunc superfamily. Plunc family. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 92747 Human
- SwissProt: Q8TDL5 Human
- Unigene: 65551 Human
-
Alternative names
- BPI fold containing family B, member 1 antibody
- C20orf114 antibody
- Long palate antibody
see all
Images
-
All lanes : Anti-BPIFB1 antibody (ab203350) at 1/200 dilution
Lane 1 : Rat lung lysate
Lane 2 : Human colon carcinoma lysate
Secondary
All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/3000 dilution
Predicted band size: 52 kDa
Observed band size: 53 kDa why is the actual band size different from the predicted?12% SDS-PAGE gel.
Datasheets and documents
References (0)
ab203350 has not yet been referenced specifically in any publications.