Overview

  • Product name

    Anti-BRCC2 antibody
  • Description

    Rabbit polyclonal to BRCC2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human BRCC2 aa 1-108.
    Sequence:

    MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEAL LGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLL CNSSAEAL


    Database link: Q8IZY5

  • Positive control

    • IHC-P: Human breast cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230129 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death.
  • Tissue specificity

    Ubiquitously expressed.
  • Cellular localization

    Cytoplasm. Mitochondrion. Lower abundance in mitochondrion than in cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • BH3-like motif containing, cell death inducer antibody
    • BH3-like motif-containing cell death inducer antibody
    • BLID antibody
    • BLID_HUMAN antibody
    • BRCC2 antibody
    • breast cancer cell 2 antibody
    • Breast cancer cell protein 2 antibody
    see all

Images

  • Paraffin-embedded human breast cancer tissue stained for BRCC2 with ab230129 at 1/100 dilution in immunohistochemical analysis.

References

ab230129 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230129.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up