Overview

  • Product name
    Anti-Brd4 antibody [CL1115]
    See all Brd4 primary antibodies
  • Description
    Mouse monoclonal [CL1115] to Brd4
  • Host species
    Mouse
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Brd4 aa 1031-1172.
    Sequence:

    PQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLT HQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLR PEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPP


    Database link: O60885

  • Epitope
    Binds to an epitope located within the peptidesequence PQPAKPQQVIQHHHSasdetermined by overlapping synthetic peptides.
  • Positive control
    • IHC-P: Human stomach cancer, testis, cerebral cortex and kidney tissues. WB: U-251 MG cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab244221 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 152 kDa.

Target

  • Function
    Plays a role in a process governing chromosomal dynamics during mitosis.
  • Tissue specificity
    Ubiquitously expressed.
  • Involvement in disease
    Note=A chromosomal aberration involving BRD4 is found in a rare, aggressive, and lethal carcinoma arising in midline organs of young people. Translocation t(15;19)(q14;p13) with NUT which produces a BRD4-NUT fusion protein.
  • Sequence similarities
    Contains 2 bromo domains.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Brd4 antibody
    • BRD4-NUT FUSION antibody
    • BRD4-NUT fusion oncoprotein antibody
    • BRD4_HUMAN antibody
    • Bromodomain containing 4 antibody
    • bromodomain containing protein 4 antibody
    • Bromodomain-containing protein 4 antibody
    • CAP antibody
    • chromosome associated protein antibody
    • HUNK1 antibody
    • HUNKI antibody
    • MCAP antibody
    • Mitotic chromosome-associated protein antibody
    • Protein HUNK1 antibody
    see all

Images

  • Paraffin-embedded human stomach cancer tissue stained for Brd4 using ab244221 at 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-Brd4 antibody [CL1115] (ab244221) at 1 µg/ml

    Lane 1 : U-251 MG (human brain glioma cell line) cell lysate transfected with control siRNA
    Lane 2 : U-251 MG cell lysate transfected with target specific siRNA probe #1
    Lane 3 : U-251 MG cell lysate transfected with target specific siRNA probe #2

    Predicted band size: 152 kDa

  • Paraffin-embedded human testis tissue stained for Brd4 using ab244221 at 1/200 dilution in immunohistochemical analysis.

  • Anti-Brd4 antibody [CL1115] (ab244221) at 1 µg/ml + U-251 MG (human brain glioma cell line) cell lysate

    Predicted band size: 152 kDa

  • Paraffin-embedded human cerebral cortex tissue stained for Brd4 using ab244221 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for Brd4 using ab244221 at 1/200 dilution in immunohistochemical analysis.

References

ab244221 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244221.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up