Overview

  • Product name

  • Description

    Rabbit polyclonal to BRD7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ChIP, ICC/IF, WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Guinea pig, Cat, Dog
  • Immunogen

    Synthetic peptide within Human BRD7 aa 594-643 (C terminal). The exact sequence is proprietary.
    Sequence:

    KELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDV


    Database link: Q9NPI1

  • Positive control

    • Jurkat cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab56036 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ChIP Use at an assay dependent concentration. PubMed: 20215511
ICC/IF Use a concentration of 1 µg/ml.
WB Use a concentration of 0.2 µg/ml. Detects a band of approximately 74 kDa (predicted molecular weight: 74 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Target

  • Function

    Acts both as coactivator and as corepressor. May play a role in chromatin remodeling. Activator of the Wnt signaling pathway in a DVL1-dependent manner by negatively regulating the GSK3B phosphotransferase activity. Induces dephosphorylation of GSK3B at 'Tyr-216'. Down-regulates TRIM24-mediated activation of transcriptional activation by AR (By similarity). Transcriptional corepressor that down-regulates the expression of target genes. Binds to target promoters, leading to increased histone H3 acetylation at 'Lys-9' (H3K9ac). Binds to the ESR1 promoter. Recruits BRCA1 and POU2F1 to the ESR1 promoter. Coactivator for TP53-mediated activation of transcription of a set of target genes. Required for TP53-mediated cell-cycle arrest in response to oncogene activation. Promotes acetylation of TP53 at 'Lys-382', and thereby promotes efficient recruitment of TP53 to target promoters. Inhibits cell cycle progression from G1 to S phase.
  • Sequence similarities

    Contains 1 bromo domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 75 kDa bromodomain protein antibody
    • BP75 antibody
    • BRD 7 antibody
    • BRD7 antibody
    • BRD7_HUMAN antibody
    • Bromodomain containing 7 antibody
    • bromodomain containing protein 7 antibody
    • Bromodomain-containing protein 7 antibody
    • CELTIX 1 antibody
    • CELTIX1 antibody
    • NAG4 antibody
    • Protein CELTIX-1 antibody
    see all

Images

  • Anti-BRD7 antibody (ab56036) at 0.2 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 74 kDa
    Observed band size: 56,74 kDa
    why is the actual band size different from the predicted?

  • ICC/IF image of ab56036 stained MCF7 cells. The cells were 100% methanol fixed (5 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab56036, 5µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899 Dylight 488 goat anti-rabbit IgG (H+L) used at a 1/250 dilution used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

  • All lanes : Anti-BRD7 antibody (ab56036) at 2.5 µg/ml

    Lane 1 : Jurkat cell lysate
    Lane 2 : Jurkat cell lysate with blocking peptide at 2 µg/ml

    Lysates/proteins at 25 µg per lane.

    Predicted band size: 74 kDa

References

This product has been referenced in:

  • Cabot B  et al. Differential expression of key subunits of SWI/SNF chromatin remodeling complexes in porcine embryos derived in vitro or in vivo. Mol Reprod Dev 84:1238-1249 (2017). ICC/IF . Read more (PubMed: 29024220) »
  • Harte MT  et al. BRD7, a subunit of SWI/SNF complexes, binds directly to BRCA1 and regulates BRCA1-dependent transcription. Cancer Res 70:2538-47 (2010). WB, ChIP ; Human . Read more (PubMed: 20215511) »
See all 2 Publications for this product

Customer reviews and Q&As

Answer

Thank you for your inquiry.

These two antibodies (ab46553, ab56036) you mentioned are polyclonal antibodies. Polyclonal antibodies consist of a mixed population of IgGs each of which will recognize a different epitope. Generally, epitope mapping experiments for polyclonal antibodies are not performed - only for monoclonal antibodies.

Regarding the immunogen sequence, if it is not commercially sensitive information, we can publish it on-line on the product datasheets. Unfortunately, we are unable to release proprietary information and this is the case for ab56036.

ab46553 and ab56036 are from two different sources and their manufacture process, purification and characterization (tested applications) are different as well. The prices of our antibodies reflect all of these factors.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any additional information or advice.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up