Anti-BRIP1 antibody (ab126517)
Key features and details
- Rabbit polyclonal to BRIP1
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-BRIP1 antibody -
Description
Rabbit polyclonal to BRIP1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human BRIP1 aa 39-103.
Sequence:PVAVEPGAAVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRW YVYCKTHPRHKQRQM
-
Positive control
- IHC-P: Human colon tissue; ICC: HeLa whole cells; WB: RT-4 and U-251 MG cell lysates.
-
General notes
This product was previously labelled as MRPL36
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab126517 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use a concentration of 0.25 - 2 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100 |
|
WB |
Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 12 kDa.
|
|
IHC-P |
1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
ICC/IF
Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
WB
Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 12 kDa. |
IHC-P
1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Component of the large subunit of the mitochondrial ribosome. -
Sequence similarities
Belongs to the ribosomal protein L36P family. -
Cellular localization
Mitochondrion. - Information by UniProt
-
Database links
- Entrez Gene: 64979 Human
- Omim: 611842 Human
- SwissProt: Q9P0J6 Human
- Unigene: 719465 Human
-
Alternative names
- 39S ribosomal protein L36 antibody
- 39S ribosomal protein L36 mitochondrial antibody
- BRCA1-interacting protein 1 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-BRIP1 antibody (ab126517)
Immunohistochemical analysis of human colon tissue labeling BRIP1 in the cytoplasm of glandular cells with ab126517 at a 1/50 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
All lanes : Anti-BRIP1 antibody (ab126517) at 0.4 µg/ml
Lane 1 : RT4 (Human urinary bladder cancer cell line) whole cell lysate
Lane 2 : U-251 MG (formally U-373 MG) (Human brain glioma cell line) whole cell lysate
Predicted band size: 12 kDa -
Immunohistochemical analysis of HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cells labeling BRIP1 in the nuclear bodies and mitochondria with ab126517 at 2 µg/ml.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab126517 has not yet been referenced specifically in any publications.