Anti-BRIP1 antibody (ab126517)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-BRIP1 antibody -
Description
Rabbit polyclonal to BRIP1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human BRIP1 aa 39-103.
Sequence:PVAVEPGAAVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRW YVYCKTHPRHKQRQM
-
Positive control
- Human colon tissue; RT-4 and U-251 MG cell lysates
-
General notes
This product was previously labelled as MRPL36
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, 59% PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab126517 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/250 - 1/500. Predicted molecular weight: 12 kDa. | |
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Component of the large subunit of the mitochondrial ribosome. -
Sequence similarities
Belongs to the ribosomal protein L36P family. -
Cellular localization
Mitochondrion. - Information by UniProt
-
Database links
- Entrez Gene: 64979 Human
- Omim: 611842 Human
- SwissProt: Q9P0J6 Human
- Unigene: 719465 Human
-
Alternative names
- 39S ribosomal protein L36 antibody
- 39S ribosomal protein L36 mitochondrial antibody
- BRCA1-interacting protein 1 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-BRIP1 antibody (ab126517)ab126517, at 1/50 dilution, staining BRIP1 in paraffin-embedded Human colon tissue by Immunohistochemistry
-
Western blot - Anti-BRIP1 antibody (ab126517)All lanes : Anti-BRIP1 antibody (ab126517) at 1/250 dilution
Lane 1 : RT-4 cell lysate
Lane 2 : U-251 MG cell lysate
Lane 3 : Human plasma lysate
Lane 4 : Human liver lysate
Lane 5 : Human tonsil lysate
Predicted band size: 12 kDa
Datasheets and documents
References
ab126517 has not yet been referenced specifically in any publications.
