Overview

  • Product name

    Anti-BRIP1 antibody
  • Description

    Rabbit polyclonal to BRIP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human BRIP1 aa 39-103.
    Sequence:

    PVAVEPGAAVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRW YVYCKTHPRHKQRQM

  • Positive control

    • Human colon tissue; RT-4 and U-251 MG cell lysates
  • General notes

     This product was previously labelled as MRPL36

     

Properties

Applications

Our Abpromise guarantee covers the use of ab126517 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 12 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Component of the large subunit of the mitochondrial ribosome.
  • Sequence similarities

    Belongs to the ribosomal protein L36P family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • 39S ribosomal protein L36 antibody
    • 39S ribosomal protein L36 mitochondrial antibody
    • BRCA1-interacting protein 1 antibody
    • BRIP1 antibody
    • L36mt antibody
    • mitochondrial antibody
    • Mitochondrial ribosomal protein L36 antibody
    • MRP L36 antibody
    • MRP-L36 antibody
    • Mrpl36 antibody
    • PRPL36 antibody
    • Putative BRCA1 interacting protein antibody
    • RM36_HUMAN antibody
    • RPMJ antibody
    see all

Images

  • ab126517, at 1/50 dilution, staining BRIP1 in paraffin-embedded Human colon tissue by Immunohistochemistry

  • All lanes : Anti-BRIP1 antibody (ab126517) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Predicted band size: 12 kDa

References

ab126517 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab126517.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up