Overview

  • Product name
  • Description
    Mouse polyclonal to BRMS1
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Full length protein corresponding to Human BRMS1 aa 1-246. (NP_056214.1).
    Sequence:

    MPVQPPSKDTEEMEAEGDSAAEMNGEEEESEEERSGSQTESEEESSEMDD EDYERRRSECVSEMLDLEKQFSELKEKLFRERLSQLRLRLEEVGAERAPE YTEPLGGLQRSLKIRIQVAGIYKGFCLDVIRNKYECELQGAKQHLESEKL LLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDKLHARGSSRSWDSLPPS KRKKAPLVSGPYIVYMLQEIDILEDWTAIKKARAAVSPQKRKSDGP


    Database link: Q9HCU9

  • Positive control
    • BRMS1 transfected 293T cell line lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172430 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 28 kDa.

Target

  • Function
    Transcriptional repressor. Down-regulates transcription activation by NF-kappa-B by promoting the deacetylation of RELA at 'Lys-310'. Promotes HDAC1 binding to promoter regions. Down-regulates expression of anti-apoptotic genes that are controlled by NF-kappa-B. Promotes apoptosis in cells that have inadequate adherence to a substrate, a process called anoikis, and may thereby inhibit metastasis. May be a mediator of metastasis suppression in breast carcinoma.
  • Tissue specificity
    Expression levels are higher in term placentas than in early placentas. Low levels of expression observed in normal pregnancies and in molar pregnancies.
  • Sequence similarities
    Belongs to the BRMS1 family.
  • Cellular localization
    Nucleus. Cytoplasm. Predominantly nuclear.
  • Information by UniProt
  • Database links
  • Alternative names
    • AV003220 antibody
    • AW554636 antibody
    • Breast cancer metastasis suppressor 1 antibody
    • Breast cancer metastasis-suppressor 1 antibody
    • BRMS1 antibody
    • BRMS1_HUMAN antibody
    • DKFZp564A063 antibody
    • MGC95128 antibody
    see all

Images

  • All lanes : Anti-BRMS1 antibody (ab172430) at 1 µg/ml

    Lane 1 : BRMS1 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 28 kDa

References

ab172430 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172430.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up