Overview

  • Product name
    Anti-Brn-2 antibody [CL6228]
    See all Brn-2 primary antibodies
  • Description
    Mouse monoclonal [CL6228] to Brn-2
  • Host species
    Mouse
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human Brn-2 aa 5-54.
    Sequence:

    ASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHP


    Database link: P20265

  • Positive control
    • WB: Mouse and human cerebral cortex tissue lysate; U-251 MG cell lysate. IHC-P: Mouse cerebral cortex and forebrain tissue. ICC/IF: U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab243045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 47 kDa.

Target

  • Function
    Transcription factor that binds preferentially to the recognition sequence which consists of two distinct half-sites, ('GCAT') and ('TAAT'), separated by a nonconserved spacer region of 0, 2, or 3 nucleotides. Positively regulates the genes under the control of corticotropin-releasing hormone (CRH) and CRH II promoters.
  • Tissue specificity
    Expressed specifically in the neuroectodermal cell lineage.
  • Sequence similarities
    Belongs to the POU transcription factor family. Class-3 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Brain 2 antibody
    • Brain specific homeobox/POU domain protein 2 antibody
    • Brain-2 antibody
    • Brain-specific homeobox/POU domain protein 2 antibody
    • BRN 2 antibody
    • Brn-2 antibody
    • BRN2 antibody
    • N Oct 3 antibody
    • N OCT 3 Gene antibody
    • N Oct3 antibody
    • Nervous system specific octamer binding transcription factor antibody
    • Nervous system-specific octamer-binding transcription factor N-Oct-3 antibody
    • OCT 7 antibody
    • Oct-7 antibody
    • OCT7 antibody
    • Octamer Binding Transcription Factor 7 antibody
    • Octamer-binding protein 7 antibody
    • Octamer-binding transcription factor 7 antibody
    • OTF 7 antibody
    • OTF-7 antibody
    • OTF7 antibody
    • PO3F2_HUMAN antibody
    • POU class 3 homeobox 2, antibody
    • POU domain class 3 transcription factor 2 antibody
    • POU domain, class 3, transcription factor 2 antibody
    • Pou3f2 antibody
    • POUF 3 antibody
    • POUF3 antibody
    • Protein Brn 2 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for Brn-2 (green) using ab243045 at 4 µg/ml in ICC/IF. Microtubules are stained red.

  • Paraffin-embedded mouse forebrain tissue stained for Brn-2 with ab243045 at 1/200 dilution in immunohistochemical analysis.

  • Anti-Brn-2 antibody [CL6228] (ab243045) at 1 µg/ml + U-251 MG (human brain glioma cell line) cell lysate

    Predicted band size: 47 kDa

  • Anti-Brn-2 antibody [CL6228] (ab243045) at 1 µg/ml + Mouse cerebral cortex tissue lysate

    Predicted band size: 47 kDa

  • Anti-Brn-2 antibody [CL6228] (ab243045) at 1 µg/ml + Human cerebral cortex tissue lysate

    Predicted band size: 47 kDa

  • Paraffin-embedded mouse cerebral cortex tissue stained for Brn-2 with ab243045 at 1/200 dilution in immunohistochemical analysis. Reactivity observed in layer 2-4 neurones.

  • Paraffin-embedded mouse cerebral cortex tissue stained for Brn-2 with ab243045 at 1/200 dilution in immunohistochemical analysis. No reactivity in layer 6 neurones.

References

ab243045 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243045.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up