Overview

  • Product name
    Anti-BRN3B / POU4F2 antibody
    See all BRN3B / POU4F2 primary antibodies
  • Description
    Rabbit polyclonal to BRN3B / POU4F2
  • Host species
    Rabbit
  • Specificity
    This antibody reacts with BRN3B / POU4F2.
  • Tested applications
    Suitable for: ICC/IF, ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to Human BRN3B/ POU4F2 aa 1-50 (N terminal).
    Sequence:

    MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSS

  • Positive control
    • WB: HepG2 whole cell lysate (ab7900). IF/ICC: SKNSH cell line

Properties

Applications

Our Abpromise guarantee covers the use of ab56026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 µg/ml.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay 1:312500.

WB Use a concentration of 0.2 µg/ml. Detects a band of approximately 40 kDa (predicted molecular weight: 43 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Transcription factor. May play a role in determining or maintaining the identities of a small subset of visual system neurons.
  • Tissue specificity
    Brain. Seems to be specific to the retina.
  • Sequence similarities
    Belongs to the POU transcription factor family. Class-4 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Cellular localization
    Nucleus speckle.
  • Information by UniProt
  • Database links
  • Alternative names
    • Brain specific homeobox/POU domain protein 3B antibody
    • Brain-3B antibody
    • Brain-specific homeobox/POU domain protein 3B antibody
    • Brn-3B antibody
    • BRN3.2 antibody
    • BRN3B antibody
    • Brn3b POU domain transcription factor antibody
    • class 4 antibody
    • PO4F2_HUMAN antibody
    • POU class 4 homeobox 2 antibody
    • POU domain antibody
    • POU domain class 4 transcription factor 2 antibody
    • POU domain protein antibody
    • POU4F2 antibody
    • transcription factor 2 antibody
    see all

Images

  • ICC/IF image of ab56026 stained Malme-3M cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab56026, 5µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899, DyLight® 488 goat anti-rabbit IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

  • Anti-BRN3B / POU4F2 antibody (ab56026) at 0.2 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 43 kDa
    Observed band size: 40 kDa
    why is the actual band size different from the predicted?

References

This product has been referenced in:
  • Liu Y  et al. Regulated differentiation of WERI-Rb-1 cells into retinal neuron-like cells. Int J Mol Med 40:1172-1184 (2017). Read more (PubMed: 28848998) »
  • Sluch VM  et al. Differentiation of human ESCs to retinal ganglion cells using a CRISPR engineered reporter cell line. Sci Rep 5:16595 (2015). Read more (PubMed: 26563826) »
See all 3 Publications for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Retina)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate Buffer
Permeabilization
Yes - Tween-20
Specification
Retina
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 25°C
Fixative
Davidson

Abcam user community

Verified customer

Submitted Sep 12 2018

Answer

Please forward this email to your customer:



Thank you very much for your interest our products.



To our knowledge, we do not have an alternative antibody which has been tested in IHC so far, although we have two more products for this target,

https://www.abcam.com/index.html?datasheet=56026 (or use the following: https://www.abcam.com/index.html?datasheet=56026).

and

https://www.abcam.com/index.html?datasheet=123856 (or use the following: https://www.abcam.com/index.html?datasheet=123856).

However by participating in our AbTrial program you can now use our products in an untested application or species without financial risk.

Simply follow these easy steps below to apply for our AbTrial Program:

1. Reply to this email, letting us know you are interested in testing in one or both of these products.

2. Our scientists will email you an inactive personal discount code for the value of the product.

3. Purchase and test the product at the regular price.

4. Submit your results, including your discount code in the additional notes section of your Abreview.

5. Once the Abreview is submitted, the discount code will become active.

6. Apply your discount code on your next order to receive that value off.

Please let me know if you have any questions about this offer and I would be happy to help you further.

The Terms and Conditions of this offer can be found at: www.abcam.com/abtrial.

Read More

Answer

Thank you for your telephone enquiry yesterday afternoon.

I am sorry to confirm that ab32264 BRN3B / POU4F2 antibodyis not longer available.

As discussed on the telephone, we do have an alternative, ab56026. I can recommend to review the online datasheet for further information.
https://www.abcam.com/index.html?datasheet=56026 (or use the following: https://www.abcam.com/index.html?datasheet=56026).

Regrettably, to our knowledge,this one has not been tested and guaranteed in mouse, rat, ICC or IHC-Fr.Unfortunately, there are no suitably tested antibodies available on this occasion in the catalog.

Therefore, I can offer a discount off a future purchase if you buy ab56026 now, test it in mouse, rat, ICC and IHC-Fr and submit feedback to us in the form of an Abreview(s). It doesn't matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of: 1 free primary antibody.

If you are interested in this offer, please follow these steps:

1. Reply to this e-mail to let me know that you would like to proceed and test ab56026 in mouse, rat, ICC and IHC-Fr. I will then send a discount code. This code must be issued before purchasing ab56026 so please wait for my reply before ordering.

2. Purchase ab56026 either by phone, fax, or online (www.abcam.com).

3. Test it in mouse, rat, ICC and IHC-Fr.

4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews. You can submit several Abreviews for the different applications and species.

5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any primary antibody ordered and the discount code is valid for 4 months after issue.

Please remember that submission of the Abreview is sufficient for the discount code to become active.

We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if ab turns out to be unsuitable formouse, rat, ICCor IHC-Fr, you will still receive the discount on your next purchase after your Abreview has been submitted.

The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.

Please let me know if you have any questions about this offer and I would be happy to help you further.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up