Overview

  • Product name
    Anti-BRN3B / POU4F2 antibody
    See all BRN3B / POU4F2 primary antibodies
  • Description
    Rabbit polyclonal to BRN3B / POU4F2
  • Host species
    Rabbit
  • Specificity
    This antibody reacts with BRN3B / POU4F2.
  • Tested applications
    Suitable for: ICC/IF, ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to Human BRN3B/ POU4F2 aa 1-50 (N terminal).
    Sequence:

    MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSS

  • Positive control
    • WB: HepG2 whole cell lysate (ab7900). IF/ICC: SKNSH cell line

Properties

Applications

Our Abpromise guarantee covers the use of ab56026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 µg/ml.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay 1:312500.

WB Use a concentration of 0.2 µg/ml. Detects a band of approximately 40 kDa (predicted molecular weight: 43 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Transcription factor. May play a role in determining or maintaining the identities of a small subset of visual system neurons.
  • Tissue specificity
    Brain. Seems to be specific to the retina.
  • Sequence similarities
    Belongs to the POU transcription factor family. Class-4 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Cellular localization
    Nucleus speckle.
  • Information by UniProt
  • Database links
  • Alternative names
    • Brain specific homeobox/POU domain protein 3B antibody
    • Brain-3B antibody
    • Brain-specific homeobox/POU domain protein 3B antibody
    • Brn-3B antibody
    • BRN3.2 antibody
    • BRN3B antibody
    • Brn3b POU domain transcription factor antibody
    • class 4 antibody
    • PO4F2_HUMAN antibody
    • POU class 4 homeobox 2 antibody
    • POU domain antibody
    • POU domain class 4 transcription factor 2 antibody
    • POU domain protein antibody
    • POU4F2 antibody
    • transcription factor 2 antibody
    see all

Images

  • ICC/IF image of ab56026 stained Malme-3M cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab56026, 5µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899, DyLight® 488 goat anti-rabbit IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

  • Anti-BRN3B / POU4F2 antibody (ab56026) at 0.2 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 43 kDa
    Observed band size: 40 kDa
    why is the actual band size different from the predicted?

References

This product has been referenced in:
  • Liu Y  et al. Regulated differentiation of WERI-Rb-1 cells into retinal neuron-like cells. Int J Mol Med 40:1172-1184 (2017). Read more (PubMed: 28848998) »
  • Sluch VM  et al. Differentiation of human ESCs to retinal ganglion cells using a CRISPR engineered reporter cell line. Sci Rep 5:16595 (2015). Read more (PubMed: 26563826) »
See all 3 Publications for this product

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Retina)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate Buffer
Permeabilization
Yes - Tween-20
Specification
Retina
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 25°C
Fixative
Davidson

Abcam user community

Verified customer

Submitted Sep 12 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up