Overview

  • Product name

    Anti-Brorin antibody
  • Description

    Sheep polyclonal to Brorin
  • Host species

    Sheep
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Human
  • Immunogen

    Recombinant full length protein corresponding to Mouse Brorin aa 28-324. Mature protein without the signal peptide. (Derived from E.coli).
    Sequence:

    SPSIPLEKLAQAPEQPGQEKREHASRDSPGRVSELGRASRDEGSSARDWK SKGSRALSGREAWSKQKQAWAAQGGSAKAADWQVRPRGDTPQGEPPAAAQ EAISLELVPTPELPEEYAYPDYRGKGCVDESGFVYAIGEKFAPGPSACPC LCTEEGPLCAQPECPRLHPRCIHVDNSQCCPQCKEKKNYCEFRGKTYQTL EEFVVSPCERCRCEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPN CFAETAVIPAGREVKTDECTICHCTYEEGTWRIERQAMCTRHECRQM


    Database link: Q8C8N3

  • Positive control

    • Mouse brain lysate.
  • General notes

    Previously labelled as VWC2.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 100% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab215057 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Detects a band of approximately 35 kDa (predicted molecular weight: 35 kDa).

Target

Images

  • Anti-Brorin antibody (ab215057) at 1/1000 dilution + Mouse brain lysate

    Predicted band size: 35 kDa
    Observed band size: 35 kDa

References

ab215057 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215057.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up