Overview

  • Product name

    Anti-BROX antibody - C-terminal
  • Description

    Rabbit polyclonal to BROX - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human BROX aa 360-409 (C terminal). The exact sequence is proprietary. NCBI Accession No. NP_653296.
    Sequence:

    PTSVQWTPETLAAFDLTKRPKDDSTKPKPEEEVKPVKEPDIKPQKDTGCY


    Database link: Q5VW32

  • Positive control

    • Jurkat whole cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab193008 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 46 kDa.

Target

  • Sequence similarities

    Belongs to the BROX family.
    Contains 1 BRO1 domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • BRO1 domain and CAAX motif containing antibody
    • BRO1 domain containing protein antibody
    • BRO1 domain- and CAAX motif-containing protein antibody
    • BRO1 domain-containing protein BROX antibody
    • BROFTI antibody
    • Brox antibody
    • BROX_HUMAN antibody
    • C1orf58 antibody
    • FLJ32421 antibody
    • hCG_25336 antibody
    • RP11-452F19.1 antibody
    see all

Images

  • Anti-BROX antibody - C-terminal (ab193008) at 1 µg/ml + Jurkat whole cell lysate at 10 µg

    Predicted band size: 46 kDa

References

ab193008 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193008.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up