Overview

  • Product name

  • Description

    Rabbit polyclonal to BSND
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human BSND aa 54-320.
    Sequence:

    CQCYPKITFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVRLWE EAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGD VQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDM DSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEP QEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGA GDLLPDKELGFEPDTQG


    Database link: Q8WZ55

  • Positive control

    • IHC-P: Human breast cancer and kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238741 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Functions as a beta-subunit for CLCNKA and CLCNKB chloride channels. In the kidney CLCNK/BSND heteromers mediate chloride reabsorption by facilitating its basolateral efflux. In the stria, CLCNK/BSND channels drive potassium secretion by recycling chloride for the basolateral SLC12A2 cotransporter.
  • Tissue specificity

    Expressed primarily in kidney. Expressed in specific nephron segments and in the stria vascularis of the inner ear.
  • Involvement in disease

    Bartter syndrome 4A
  • Cellular localization

    Cell membrane. Cytoplasm. A significant amount also observed intracellularly. Staining in membranes of the renal tubule and of potassium-secreting epithelia of the inner ear is basolateral.
  • Information by UniProt
  • Database links

  • Alternative names

    • BART antibody
    • Bartter syndrome infantile with sensorineural deafness antibody
    • Bartter syndrome, infantile, with sensorineural deafness (Barttin) antibody
    • Barttin antibody
    • Bsnd antibody
    • BSND_HUMAN antibody
    • deafness, autosomal recessive 73 antibody
    • DFNB 73 antibody
    • DFNB73 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for BSND using ab238741 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human breats cancer tissue stained for BSND using ab238741 at 1/100 dilution in immunohistochemical analysis.

References

ab238741 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238741.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up