Overview

  • Product name

  • Description

    Rabbit polyclonal to BSX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human BSX aa 1-233.
    Sequence:

    MNLNFTSPLHPASSQRPTSFFIEDILLHKPKPLREVAPDHFASSLASRVP LLDYGYPLMPTPTLLAPHAHHPLHKGDHHHPYFLTTSGMPVPALFPHPQH AELPGKHCRRRKARTVFSDSQLSGLEKRFEIQRYLSTPERVELATALSLS ETQVKTWFQNRRMKHKKQLRKSQDEPKAPDGPESPEGSPRGSEAATAAEA RLSLPAGPFVLTEPEDEVDIGDEGELGSGPHVL


    Database link: Q3C1V8

  • Positive control

    • IHC-P: Human glioma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab236983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000.

Target

  • Relevance

    BSX(Brain-specific homeobox protein homolog) may play a role in the determination and function of cell types in the brain. In brain, it is restricted to a few specific developing brain structures such as pineal gland, telencephalic septum, hypothalamic pre-mammillary body and arcuate nucleus. Bsx might be considered an important molecular marker for early embryonic stages of epiphysis development. It belongs to the distal-less homeobox family and contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • Brain specific homeobox antibody
    • Brain specific homeobox protein homolog antibody
    • Brain specific homeobox, mouse, homolog of antibody
    • BSH antibody
    • BSX1 antibody
    see all

Images

  • Paraffin-embedded human glioma tissue stained for BSX with ab236983 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab236983 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up