Overview

  • Product name

    Anti-BTBD1 antibody
  • Description

    Rabbit polyclonal to BTBD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human BTBD1 aa 32-62.
    Sequence:

    SSLGPLLPLQREPLYNWQATKASLKERFAFL


    Database link: Q9H0C5

  • Positive control

    • Human heart muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab204550 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    BTBD1 contains a proline-rich region and a BTB/POZ domain which are typically involved in protein-protein interactions. The C-terminus of BTBD1 binds topoisomerase I and BTBD1 also interacts with TRIM5 isoform Delta. BTBD1 localizes to cytoplasmic bodies and is essential for myogenic differentiation.
  • Cellular localization

    Cytoplasm, P-body. Cytoplasmic bodies.
  • Database links

  • Alternative names

    • BTB (POZ) domain containing 1 antibody
    • BTB domain containing 1 antibody
    • BTB/POZ domain containing protein 1 antibody
    • BTBD 1 antibody
    • C15orf1 antibody
    • HCV NS5A transactivated protein 8 antibody
    • Hepatitis C virus NS5A transactivated protein 8 antibody
    • NS5ATP8 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human heart muscle tissue, labeling BTBD1 using ab204550 at a 1/200 dilution.

References

ab204550 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204550.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up