
  • Product name

    Anti-BTG1 antibody [2095C1a]
    See all BTG1 primary antibodies
  • Description

    Mouse monoclonal [2095C1a] to BTG1
  • Host species

  • Specificity

    ab50991 has not yet been tested on endogenous protein in cell lysate.
  • Tested applications

    Suitable for: Dot blot, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment of BTG1 (Human)



Our Abpromise guarantee covers the use of ab50991 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Dot blot Use at an assay dependent dilution.
WB Use at an assay dependent dilution. Predicted molecular weight: 19 kDa.


  • Relevance

    BTG1 belongs to the BTG family of proteins.FUNCTION: Anti-proliferative protein. Its expression is associated with the early G1 phase of the cell cycle. A chromosomal aberration involving BTG1 may be a cause of a form of B cell chronic lymphocytic leukemia; translocation t(8;12)(q24;q22) with MYC.
  • Database links

  • Alternative names

    • B cell translocation gene 1 protein antibody
    • B cell translocation gene 1, anti proliferative antibody
    • BTG1 protein antibody
    • Protein BTG1 antibody



This product has been referenced in:

  • Liu C  et al. BTG1 potentiates apoptosis and suppresses proliferation in renal cell carcinoma by interacting with PRMT1. Oncol Lett 10:619-624 (2015). WB, IHC . Read more (PubMed: 26622543) »
See 1 Publication for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Western blot
Human Cell lysate - whole cell (RS411 (B-cell leukemia))
Loading amount
100000 cells
RS411 (B-cell leukemia)
5µM MG132 over night
Gel Running Conditions
Reduced Denaturing
Blocking step
2% milk + 1% BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Dec 01 2010

Human Cell lysate - whole cell (RS411 (B-cell leukemia))
RS411 (B-cell leukemia)
Cross-linking (X-ChIP)
Duration of cross-linking step: 30 minute(s) and 0 second(s)
Specification of the cross-linking agent: 1% Formaldehyde in EDTA/EGTA/H
Detection step
Real-time PCR
Positive control
ChIP on TBP and Glucocorticoid Receptor
Negative control
Isotype control

Abcam user community

Verified customer

Submitted Dec 01 2010


Thank you for your patience in this matter. The originator of ab50991 (ab50991 BTG1 antibody [2095C1a]) has provided the following information: The WB image was obtained under the following conditions: -Primary Ab dilution; 1:100 -Secondary Ab dilution; 1:3000 -Immunogen amount; 50ng/lane -Secondary Ab detail; Sheep anti mouse IgG Original Concentration; Antibody 0.63mg/ml HRP 0.78mg/ml -Immunogen detail; Sequence: LIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEELL LGRTSPSKNYNMMT MW of Tag: approx. 20kDa The crossreactivity of ab50991 to BTG2 has not been examined. However, the product is unlikely to crossreact since BTG1 and BTG2 are ~60% homologous. Please don't hesitate to contact us again if you have any further questions.

Read More

For licensing inquiries, please contact partnerships@abcam.com

Sign up