Overview

  • Product name

  • Description

    Rabbit polyclonal to BTG2/PC3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human BTG2/PC3 aa 43-144.
    Sequence:

    QEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQL HQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVL LG


    Database link: P78543

  • Positive control

    • IHC-P: Human cerebellum tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab244260 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Formalin-fixed, paraffin-embedded human cerebellum tissue stained for BTG2/PC3 with ab244260 at a 1/200 dilution in immunohistochemical analysis.

  • PFA fixed, Triton X-100 permeabilized A431 (Human epidermoid carcinoma cell line) cells labeling BTG2/PC3 using ab244260 at 4 µg/ml (green) in ICC/IF.

References

ab244260 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244260.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up