Overview

  • Product name

    Anti-BUD13 antibody
  • Description

    Rabbit polyclonal to BUD13
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human BUD13 aa 269-352.
    Sequence:

    HDSPDLAPNVTYSLPRTKSGKAPERASSKTSPHWKESGASHLSFPKNSKY EYDPDISPPRKKQAKSHFGDKKQLDSKGDCQKAT


    Database link: Q9BRD0

  • Positive control

    • Human testis tissue; A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204755 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Sequence similarities

    Belongs to the CWC26 family.
  • Information by UniProt
  • Database links

  • Alternative names

    • Bud13 antibody
    • BUD13 homolog (S. cerevisiae) antibody
    • BUD13 homolog antibody
    • BUD13_HUMAN antibody
    • Cwc26 antibody
    • FLJ27090 antibody
    • fSAP71 antibody
    • Functional spliceosome-associated protein 71 antibody
    • MGC13125 antibody
    • OTTHUMP00000042639 antibody
    • OTTHUMP00000042640 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue labeling BUD13 with ab204755 at 1/50 dilution.

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling BUD13 with ab204755 at 4 µg/ml (green).

References

ab204755 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204755.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up