Overview

  • Product name

  • Description

    Rabbit polyclonal to BUD31
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow, Zebrafish
  • Immunogen

    Recombinant full length protein corresponding to Human BUD31 aa 1-144.
    Sequence:

    MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIF RIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENL CCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG


    Database link: P41223

  • Positive control

    • WB: Jurkat, Raji, NIH/3T3, K562, HepG2 and U-251 MG whole cell lysate; Mouse liver lysate. IHC-P: Human colon cancer and spleen tissues. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237493 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 17 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

Images

  • All lanes : Anti-BUD31 antibody (ab237493) at 1/500 dilution

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : Mouse liver lysate
    Lane 3 : Raji (human Burkitt's lymphoma cell line) whole cell lysate
    Lane 4 : NIH/3T3 (mouse embyro fibroblast cell line) whole cell lysate
    Lane 5 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 6 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 7 : U-251 MG (human brain glioma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 17 kDa

  • Paraffin-embedded human colon cancer tissue stained for BUD31 using ab237493 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human spleen tissue stained for BUD31 using ab237493 at 1/100 dilution in immunohistochemical analysis.

  • MCF7 (human breast adenocarcinoma cell line) cells stained for BUD31 (green) using ab237493 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab237493 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237493.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up