Overview

  • Product name

    Anti-Butyrylcholinesterase antibody
    See all Butyrylcholinesterase primary antibodies
  • Description

    Rabbit polyclonal to Butyrylcholinesterase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit, Horse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human Butyrylcholinesterase aa 311-524.
    Sequence:

    GTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVGVNKDEGTAFLVY GAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRP ENYREALGDVVGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPE WMGVMHGYEIEFVFGLPLERRDNYTKAEEILSRSIVKRWANFAKYGNPNE TQNNSTSWPVFKST


    Database link: P06276

  • Positive control

    • WB: K562 whole cell lysate. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236577 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 68 kDa.

Target

  • Function

    Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters.
  • Tissue specificity

    Detected in blood plasma (at protein level). Present in most cells except erythrocytes.
  • Involvement in disease

    Defects in BCHE are the cause of butyrylcholinesterase deficiency (BChE deficiency) [MIM:177400]. BChE deficiency is a metabolic disorder characterized by prolonged apnoea after the use of certain anesthetic drugs, including the muscle relaxants succinylcholine or mivacurium and other ester local anesthetics. The duration of the prolonged apnoea varies significantly depending on the extent of the enzyme deficiency. BChE deficiency is a multifactorial disorder. The hereditary condition is transmitted as an autosomal recessive trait.
  • Sequence similarities

    Belongs to the type-B carboxylesterase/lipase family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acylcholine acylhydrolase antibody
    • BCHE antibody
    • Butyrylcholine esterase antibody
    • CHE1 antibody
    • CHE2 antibody
    • CHLE_HUMAN antibody
    • Choline esterase II antibody
    • Cholinesterase (serum) 2 antibody
    • Cholinesterase 1 antibody
    • Cholinesterase antibody
    • E1 antibody
    • Pseudocholinesterase antibody
    • Pseudocholinesterase E1 antibody
    see all

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Butyrylcholinesterase (Green) using ab236577 at a 1/100 dilution in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Anti-Butyrylcholinesterase antibody (ab236577) at 1/500 dilution + K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 68 kDa

References

ab236577 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236577.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up