Overview

  • Product name

    Anti-Butyrylcholinesterase antibody [OTI4C12]
    See all Butyrylcholinesterase primary antibodies
  • Description

    Mouse monoclonal [OTI4C12] to Butyrylcholinesterase
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Butyrylcholinesterase. Produced in HEK293T cells (NP_000046).
    Sequence:

    MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVRGMNLTVFG GTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQS FPGFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGT SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ LALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAIL QSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEI LLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVGVN KDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFH YTDWVDDQRPENYREALGDVVGDYNFICPALEFTKKFSEWGNNAFFYYFE HRSSKLPWPEWMGVMHGYEIEFVFGLPLERRDNYTKAEEILSRSIVKRWA NFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFW TSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCV GL


    Database link: P06276

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY butyrylcholinesterase cDNA.
  • General notes

    Clone OTI4C12 (formerly 4C12).

Properties

Applications

Our Abpromise guarantee covers the use of ab117960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 68 kDa.

Target

  • Function

    Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters.
  • Tissue specificity

    Detected in blood plasma (at protein level). Present in most cells except erythrocytes.
  • Involvement in disease

    Defects in BCHE are the cause of butyrylcholinesterase deficiency (BChE deficiency) [MIM:177400]. BChE deficiency is a metabolic disorder characterized by prolonged apnoea after the use of certain anesthetic drugs, including the muscle relaxants succinylcholine or mivacurium and other ester local anesthetics. The duration of the prolonged apnoea varies significantly depending on the extent of the enzyme deficiency. BChE deficiency is a multifactorial disorder. The hereditary condition is transmitted as an autosomal recessive trait.
  • Sequence similarities

    Belongs to the type-B carboxylesterase/lipase family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acylcholine acylhydrolase antibody
    • BCHE antibody
    • Butyrylcholine esterase antibody
    • CHE1 antibody
    • CHE2 antibody
    • CHLE_HUMAN antibody
    • Choline esterase II antibody
    • Cholinesterase (serum) 2 antibody
    • Cholinesterase 1 antibody
    • Cholinesterase antibody
    • E1 antibody
    • Pseudocholinesterase antibody
    • Pseudocholinesterase E1 antibody
    see all

Images

  • All lanes : Anti-Butyrylcholinesterase antibody [OTI4C12] (ab117960) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY Butyrylcholinesterase cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 68 kDa

References

ab117960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up