Overview

  • Product name

  • Description

    Rabbit polyclonal to BVR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human BVR aa 4-95.
    Sequence:

    EPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDG VQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVL


    Database link: P53004

  • Positive control

    • WB: RPMI-8226 cell lysate. IHC-P: Human spleen tissue.
  • General notes

    Protein previously labeled as Biliverdin Reductase.

Properties

Applications

Our Abpromise guarantee covers the use of ab223723 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 33 kDa.

Target

  • Function

    Reduces the gamma-methene bridge of the open tetrapyrrole, biliverdin IX alpha, to bilirubin with the concomitant oxidation of a NADH or NADPH cofactor.
  • Tissue specificity

    Liver.
  • Pathway

    Porphyrin-containing compound metabolism; protoheme degradation.
  • Involvement in disease

    Hyperbiliverdinemia
  • Sequence similarities

    Belongs to the Gfo/Idh/MocA family. Biliverdin reductase subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • BIEA_HUMAN antibody
    • Biliverdin IX alpha reductase antibody
    • Biliverdin reductase A antibody
    • Biliverdin-IX alpha-reductase antibody
    • BLVR A antibody
    • BLVR antibody
    • Blvra antibody
    • BVR A antibody
    • BVR antibody
    • BVRA antibody
    • Zinc metalloprotein antibody
    see all

Images

  • Paraffin embedded human spleen tissue stained for BVR with ab223723 (1/50 dilution) in immunohistochemical analysis.

  • Anti-BVR antibody (ab223723) at 1/100 dilution + RPMI-8226 cell lysate

    Predicted band size: 33 kDa

References

ab223723 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223723.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up